commit
stringlengths
40
40
old_file
stringlengths
4
118
new_file
stringlengths
4
118
old_contents
stringlengths
0
2.94k
new_contents
stringlengths
1
4.43k
subject
stringlengths
15
444
message
stringlengths
16
3.45k
lang
stringclasses
1 value
license
stringclasses
13 values
repos
stringlengths
5
43.2k
prompt
stringlengths
17
4.58k
response
stringlengths
1
4.43k
prompt_tagged
stringlengths
58
4.62k
response_tagged
stringlengths
1
4.43k
text
stringlengths
132
7.29k
text_tagged
stringlengths
173
7.33k
03d71787ef04627b620cbf234a0413b136b66ce1
main.py
main.py
#!/usr/bin/env python import asyncio import logging import sys import discord from discord.ext.commands import when_mentioned_or import yaml from bot import BeattieBot try: import uvloop except ImportError: pass else: asyncio.set_event_loop_policy(uvloop.EventLoopPolicy()) with open('config.yaml') as fi...
#!/usr/bin/env python import asyncio import logging import sys import discord from discord.ext.commands import when_mentioned_or import yaml from bot import BeattieBot try: import uvloop except ImportError: pass else: asyncio.set_event_loop_policy(uvloop.EventLoopPolicy()) with open('config.yaml') as fi...
Load stats on startup, don't load nsfw
Load stats on startup, don't load nsfw
Python
mit
BeatButton/beattie,BeatButton/beattie-bot
#!/usr/bin/env python import asyncio import logging import sys import discord from discord.ext.commands import when_mentioned_or import yaml from bot import BeattieBot try: import uvloop except ImportError: pass else: asyncio.set_event_loop_policy(uvloop.EventLoopPolicy()) with open('config.yaml') as fi...
#!/usr/bin/env python import asyncio import logging import sys import discord from discord.ext.commands import when_mentioned_or import yaml from bot import BeattieBot try: import uvloop except ImportError: pass else: asyncio.set_event_loop_policy(uvloop.EventLoopPolicy()) with open('config.yaml') as fi...
<commit_before>#!/usr/bin/env python import asyncio import logging import sys import discord from discord.ext.commands import when_mentioned_or import yaml from bot import BeattieBot try: import uvloop except ImportError: pass else: asyncio.set_event_loop_policy(uvloop.EventLoopPolicy()) with open('conf...
#!/usr/bin/env python import asyncio import logging import sys import discord from discord.ext.commands import when_mentioned_or import yaml from bot import BeattieBot try: import uvloop except ImportError: pass else: asyncio.set_event_loop_policy(uvloop.EventLoopPolicy()) with open('config.yaml') as fi...
#!/usr/bin/env python import asyncio import logging import sys import discord from discord.ext.commands import when_mentioned_or import yaml from bot import BeattieBot try: import uvloop except ImportError: pass else: asyncio.set_event_loop_policy(uvloop.EventLoopPolicy()) with open('config.yaml') as fi...
<commit_before>#!/usr/bin/env python import asyncio import logging import sys import discord from discord.ext.commands import when_mentioned_or import yaml from bot import BeattieBot try: import uvloop except ImportError: pass else: asyncio.set_event_loop_policy(uvloop.EventLoopPolicy()) with open('conf...
89fcf556d6b6086434ea961c19b770ffd3fdc7be
main.py
main.py
#!/usr/bin/env python """ This is the main file. The script finds the game window and sets up the coordinates for each block. The MIT License (MIT) (c) 2016 """ def main(): """ No inputs No outputs Starts up the gameregionfinder """ if __name__ == "__main__": main()
#!/usr/bin/env python """ This is the main file. The script finds the game window and sets up the coordinates for each block. The MIT License (MIT) (c) 2016 """ import pyautogui, logging, time logging.basicConfig(level=logging.DEBUG, format='%(asctime)s.%(msecs)03d: %(message)s', datefmt='%H:%M:%S') # logging.d...
Add imports, logging configs, and authorship info
Add imports, logging configs, and authorship info
Python
mit
hydrophilicsun/Automating-Minesweeper-
#!/usr/bin/env python """ This is the main file. The script finds the game window and sets up the coordinates for each block. The MIT License (MIT) (c) 2016 """ def main(): """ No inputs No outputs Starts up the gameregionfinder """ if __name__ == "__main__": main() Add imports, logg...
#!/usr/bin/env python """ This is the main file. The script finds the game window and sets up the coordinates for each block. The MIT License (MIT) (c) 2016 """ import pyautogui, logging, time logging.basicConfig(level=logging.DEBUG, format='%(asctime)s.%(msecs)03d: %(message)s', datefmt='%H:%M:%S') # logging.d...
<commit_before>#!/usr/bin/env python """ This is the main file. The script finds the game window and sets up the coordinates for each block. The MIT License (MIT) (c) 2016 """ def main(): """ No inputs No outputs Starts up the gameregionfinder """ if __name__ == "__main__": main() <c...
#!/usr/bin/env python """ This is the main file. The script finds the game window and sets up the coordinates for each block. The MIT License (MIT) (c) 2016 """ import pyautogui, logging, time logging.basicConfig(level=logging.DEBUG, format='%(asctime)s.%(msecs)03d: %(message)s', datefmt='%H:%M:%S') # logging.d...
#!/usr/bin/env python """ This is the main file. The script finds the game window and sets up the coordinates for each block. The MIT License (MIT) (c) 2016 """ def main(): """ No inputs No outputs Starts up the gameregionfinder """ if __name__ == "__main__": main() Add imports, logg...
<commit_before>#!/usr/bin/env python """ This is the main file. The script finds the game window and sets up the coordinates for each block. The MIT License (MIT) (c) 2016 """ def main(): """ No inputs No outputs Starts up the gameregionfinder """ if __name__ == "__main__": main() <c...
ff7b10fe2b32f6c6b988ac1094c494cb986dded4
tests/smolder_tests.py
tests/smolder_tests.py
#!/usr/bin/env python2 import smolder import nose import json import os from nose.tools import assert_raises from imp import reload THIS_DIR = os.path.dirname(os.path.realpath(__file__)) def test_noop_test(): assert smolder.noop_test() def test_github_status(): myfile = open(THIS_DIR + '/github_status.json') t...
#!/usr/bin/env python2 import smolder import json import os from nose.tools import assert_raises from imp import reload THIS_DIR = os.path.dirname(os.path.realpath(__file__)) def test_noop_test(): assert smolder.noop_test() def test_github_status(): myfile = open(THIS_DIR + '/github_status.json') test_json = j...
Clean up imports in smolder tests
Clean up imports in smolder tests
Python
bsd-3-clause
sky-shiny/smolder,sky-shiny/smolder
#!/usr/bin/env python2 import smolder import nose import json import os from nose.tools import assert_raises from imp import reload THIS_DIR = os.path.dirname(os.path.realpath(__file__)) def test_noop_test(): assert smolder.noop_test() def test_github_status(): myfile = open(THIS_DIR + '/github_status.json') t...
#!/usr/bin/env python2 import smolder import json import os from nose.tools import assert_raises from imp import reload THIS_DIR = os.path.dirname(os.path.realpath(__file__)) def test_noop_test(): assert smolder.noop_test() def test_github_status(): myfile = open(THIS_DIR + '/github_status.json') test_json = j...
<commit_before>#!/usr/bin/env python2 import smolder import nose import json import os from nose.tools import assert_raises from imp import reload THIS_DIR = os.path.dirname(os.path.realpath(__file__)) def test_noop_test(): assert smolder.noop_test() def test_github_status(): myfile = open(THIS_DIR + '/github_st...
#!/usr/bin/env python2 import smolder import json import os from nose.tools import assert_raises from imp import reload THIS_DIR = os.path.dirname(os.path.realpath(__file__)) def test_noop_test(): assert smolder.noop_test() def test_github_status(): myfile = open(THIS_DIR + '/github_status.json') test_json = j...
#!/usr/bin/env python2 import smolder import nose import json import os from nose.tools import assert_raises from imp import reload THIS_DIR = os.path.dirname(os.path.realpath(__file__)) def test_noop_test(): assert smolder.noop_test() def test_github_status(): myfile = open(THIS_DIR + '/github_status.json') t...
<commit_before>#!/usr/bin/env python2 import smolder import nose import json import os from nose.tools import assert_raises from imp import reload THIS_DIR = os.path.dirname(os.path.realpath(__file__)) def test_noop_test(): assert smolder.noop_test() def test_github_status(): myfile = open(THIS_DIR + '/github_st...
6e80bcef30b6b4485fa5e3f269f13fc62380c422
tests/test_evaluate.py
tests/test_evaluate.py
import numpy as np from numpy.testing import assert_equal from gala import evaluate as ev def test_contingency_table(): seg = np.array([0, 1, 1, 1, 2, 2, 2, 3]) gt = np.array([1, 1, 1, 2, 2, 2, 2, 0]) ct = ev.contingency_table(seg, gt, ignore_seg=[], ignore_gt=[]) ct0 = ev.contingency_table(seg, gt, ig...
import numpy as np from numpy.testing import assert_equal from gala import evaluate as ev def test_contingency_table(): seg = np.array([0, 1, 1, 1, 2, 2, 2, 3]) gt = np.array([1, 1, 1, 2, 2, 2, 2, 0]) ct = ev.contingency_table(seg, gt, ignore_seg=[], ignore_gt=[]) ct0 = ev.contingency_table(seg, gt, ig...
Add in test for ARE
Add in test for ARE
Python
bsd-3-clause
jni/gala,janelia-flyem/gala
import numpy as np from numpy.testing import assert_equal from gala import evaluate as ev def test_contingency_table(): seg = np.array([0, 1, 1, 1, 2, 2, 2, 3]) gt = np.array([1, 1, 1, 2, 2, 2, 2, 0]) ct = ev.contingency_table(seg, gt, ignore_seg=[], ignore_gt=[]) ct0 = ev.contingency_table(seg, gt, ig...
import numpy as np from numpy.testing import assert_equal from gala import evaluate as ev def test_contingency_table(): seg = np.array([0, 1, 1, 1, 2, 2, 2, 3]) gt = np.array([1, 1, 1, 2, 2, 2, 2, 0]) ct = ev.contingency_table(seg, gt, ignore_seg=[], ignore_gt=[]) ct0 = ev.contingency_table(seg, gt, ig...
<commit_before>import numpy as np from numpy.testing import assert_equal from gala import evaluate as ev def test_contingency_table(): seg = np.array([0, 1, 1, 1, 2, 2, 2, 3]) gt = np.array([1, 1, 1, 2, 2, 2, 2, 0]) ct = ev.contingency_table(seg, gt, ignore_seg=[], ignore_gt=[]) ct0 = ev.contingency_ta...
import numpy as np from numpy.testing import assert_equal from gala import evaluate as ev def test_contingency_table(): seg = np.array([0, 1, 1, 1, 2, 2, 2, 3]) gt = np.array([1, 1, 1, 2, 2, 2, 2, 0]) ct = ev.contingency_table(seg, gt, ignore_seg=[], ignore_gt=[]) ct0 = ev.contingency_table(seg, gt, ig...
import numpy as np from numpy.testing import assert_equal from gala import evaluate as ev def test_contingency_table(): seg = np.array([0, 1, 1, 1, 2, 2, 2, 3]) gt = np.array([1, 1, 1, 2, 2, 2, 2, 0]) ct = ev.contingency_table(seg, gt, ignore_seg=[], ignore_gt=[]) ct0 = ev.contingency_table(seg, gt, ig...
<commit_before>import numpy as np from numpy.testing import assert_equal from gala import evaluate as ev def test_contingency_table(): seg = np.array([0, 1, 1, 1, 2, 2, 2, 3]) gt = np.array([1, 1, 1, 2, 2, 2, 2, 0]) ct = ev.contingency_table(seg, gt, ignore_seg=[], ignore_gt=[]) ct0 = ev.contingency_ta...
11fb371098b258348e5b9efc92abe31f2cac5ef3
tests/test_settings.py
tests/test_settings.py
from os.path import dirname, join TEST_ROOT = dirname(__file__) INSTALLED_APPS = ('adminfiles', 'tests', 'django.contrib.contenttypes', 'django.contrib.admin', 'django.contrib.sites', 'django.contrib.auth', 'django.contrib.sessio...
from os.path import dirname, join TEST_ROOT = dirname(__file__) INSTALLED_APPS = ('adminfiles', 'tests', 'django.contrib.contenttypes', 'django.contrib.admin', 'django.contrib.sites', 'django.contrib.auth', 'django.contrib.sessio...
Fix deprecation warning: DATABASE_* -> DATABASES
Fix deprecation warning: DATABASE_* -> DATABASES
Python
bsd-3-clause
carljm/django-adminfiles,carljm/django-adminfiles,carljm/django-adminfiles
from os.path import dirname, join TEST_ROOT = dirname(__file__) INSTALLED_APPS = ('adminfiles', 'tests', 'django.contrib.contenttypes', 'django.contrib.admin', 'django.contrib.sites', 'django.contrib.auth', 'django.contrib.sessio...
from os.path import dirname, join TEST_ROOT = dirname(__file__) INSTALLED_APPS = ('adminfiles', 'tests', 'django.contrib.contenttypes', 'django.contrib.admin', 'django.contrib.sites', 'django.contrib.auth', 'django.contrib.sessio...
<commit_before>from os.path import dirname, join TEST_ROOT = dirname(__file__) INSTALLED_APPS = ('adminfiles', 'tests', 'django.contrib.contenttypes', 'django.contrib.admin', 'django.contrib.sites', 'django.contrib.auth', 'django...
from os.path import dirname, join TEST_ROOT = dirname(__file__) INSTALLED_APPS = ('adminfiles', 'tests', 'django.contrib.contenttypes', 'django.contrib.admin', 'django.contrib.sites', 'django.contrib.auth', 'django.contrib.sessio...
from os.path import dirname, join TEST_ROOT = dirname(__file__) INSTALLED_APPS = ('adminfiles', 'tests', 'django.contrib.contenttypes', 'django.contrib.admin', 'django.contrib.sites', 'django.contrib.auth', 'django.contrib.sessio...
<commit_before>from os.path import dirname, join TEST_ROOT = dirname(__file__) INSTALLED_APPS = ('adminfiles', 'tests', 'django.contrib.contenttypes', 'django.contrib.admin', 'django.contrib.sites', 'django.contrib.auth', 'django...
0bdea433da15d70ce841edbffb9316085ca8a647
main.py
main.py
#! /usr/bin/env python import numpy as np def plot_elevation(avulsion): import matplotlib.pyplot as plt z = avulsion.get_value('land_surface__elevation') plt.imshow(z, origin='lower', cmap='terrain') plt.colorbar().ax.set_label('Elevation (m)') plt.show() def main(): import argparse fr...
#! /usr/bin/env python import sys import numpy as np def plot_elevation(avulsion): import matplotlib.pyplot as plt z = avulsion.get_value('land_surface__elevation') plt.imshow(z, origin='lower', cmap='terrain') plt.colorbar().ax.set_label('Elevation (m)') plt.show() def main(): import arg...
Print final surface elevations to stdout.
Print final surface elevations to stdout.
Python
mit
mcflugen/avulsion-bmi,katmratliff/avulsion-bmi
#! /usr/bin/env python import numpy as np def plot_elevation(avulsion): import matplotlib.pyplot as plt z = avulsion.get_value('land_surface__elevation') plt.imshow(z, origin='lower', cmap='terrain') plt.colorbar().ax.set_label('Elevation (m)') plt.show() def main(): import argparse fr...
#! /usr/bin/env python import sys import numpy as np def plot_elevation(avulsion): import matplotlib.pyplot as plt z = avulsion.get_value('land_surface__elevation') plt.imshow(z, origin='lower', cmap='terrain') plt.colorbar().ax.set_label('Elevation (m)') plt.show() def main(): import arg...
<commit_before>#! /usr/bin/env python import numpy as np def plot_elevation(avulsion): import matplotlib.pyplot as plt z = avulsion.get_value('land_surface__elevation') plt.imshow(z, origin='lower', cmap='terrain') plt.colorbar().ax.set_label('Elevation (m)') plt.show() def main(): import ...
#! /usr/bin/env python import sys import numpy as np def plot_elevation(avulsion): import matplotlib.pyplot as plt z = avulsion.get_value('land_surface__elevation') plt.imshow(z, origin='lower', cmap='terrain') plt.colorbar().ax.set_label('Elevation (m)') plt.show() def main(): import arg...
#! /usr/bin/env python import numpy as np def plot_elevation(avulsion): import matplotlib.pyplot as plt z = avulsion.get_value('land_surface__elevation') plt.imshow(z, origin='lower', cmap='terrain') plt.colorbar().ax.set_label('Elevation (m)') plt.show() def main(): import argparse fr...
<commit_before>#! /usr/bin/env python import numpy as np def plot_elevation(avulsion): import matplotlib.pyplot as plt z = avulsion.get_value('land_surface__elevation') plt.imshow(z, origin='lower', cmap='terrain') plt.colorbar().ax.set_label('Elevation (m)') plt.show() def main(): import ...
1ee1496439f4dcd654df0a1f119b05a8288e3dd2
query.py
query.py
from numpy import uint16 from numpy import bool_ from query_result_list import QueryResultList from data_record import DataRecord from has_actions import HasActions class Query(DataRecord, HasActions): def __init__(self, query_id, topic = None, result_list = None, user = None, condition = None, autocomplete = Non...
from numpy import uint16 from numpy import bool_ from query_result_list import QueryResultList from data_record import DataRecord from has_actions import HasActions class Query(DataRecord, HasActions): def __init__(self, query_id, topic = None, user = None, condition = None, autocomplete = None, query_text = None...
Remove result list handling from Query constructor
Remove result list handling from Query constructor
Python
mit
fire-uta/iiix-data-parser
from numpy import uint16 from numpy import bool_ from query_result_list import QueryResultList from data_record import DataRecord from has_actions import HasActions class Query(DataRecord, HasActions): def __init__(self, query_id, topic = None, result_list = None, user = None, condition = None, autocomplete = Non...
from numpy import uint16 from numpy import bool_ from query_result_list import QueryResultList from data_record import DataRecord from has_actions import HasActions class Query(DataRecord, HasActions): def __init__(self, query_id, topic = None, user = None, condition = None, autocomplete = None, query_text = None...
<commit_before>from numpy import uint16 from numpy import bool_ from query_result_list import QueryResultList from data_record import DataRecord from has_actions import HasActions class Query(DataRecord, HasActions): def __init__(self, query_id, topic = None, result_list = None, user = None, condition = None, aut...
from numpy import uint16 from numpy import bool_ from query_result_list import QueryResultList from data_record import DataRecord from has_actions import HasActions class Query(DataRecord, HasActions): def __init__(self, query_id, topic = None, user = None, condition = None, autocomplete = None, query_text = None...
from numpy import uint16 from numpy import bool_ from query_result_list import QueryResultList from data_record import DataRecord from has_actions import HasActions class Query(DataRecord, HasActions): def __init__(self, query_id, topic = None, result_list = None, user = None, condition = None, autocomplete = Non...
<commit_before>from numpy import uint16 from numpy import bool_ from query_result_list import QueryResultList from data_record import DataRecord from has_actions import HasActions class Query(DataRecord, HasActions): def __init__(self, query_id, topic = None, result_list = None, user = None, condition = None, aut...
3884cfe88486342232f509c14349ae9f7c13adc6
setup.py
setup.py
import os from setuptools import setup, find_packages VERSION = '0.1.3a1' README_FILENAME = 'README.rst' readme = open(os.path.join(os.path.dirname(__file__), README_FILENAME)) long_description = readme.read() readme.close() setup( name='django-cbv-formpreview', version=VERSION, author='Ryan Kaskel', ...
import os from setuptools import setup, find_packages VERSION = '0.2.0a1' README_FILENAME = 'README.rst' readme = open(os.path.join(os.path.dirname(__file__), README_FILENAME)) long_description = readme.read() readme.close() setup( name='django-cbv-formpreview', version=VERSION, author='Ryan Kaskel', ...
Update package data and version number.
Update package data and version number.
Python
bsd-3-clause
ryankask/django-cbv-formpreview,ryankask/django-cbv-formpreview
import os from setuptools import setup, find_packages VERSION = '0.1.3a1' README_FILENAME = 'README.rst' readme = open(os.path.join(os.path.dirname(__file__), README_FILENAME)) long_description = readme.read() readme.close() setup( name='django-cbv-formpreview', version=VERSION, author='Ryan Kaskel', ...
import os from setuptools import setup, find_packages VERSION = '0.2.0a1' README_FILENAME = 'README.rst' readme = open(os.path.join(os.path.dirname(__file__), README_FILENAME)) long_description = readme.read() readme.close() setup( name='django-cbv-formpreview', version=VERSION, author='Ryan Kaskel', ...
<commit_before>import os from setuptools import setup, find_packages VERSION = '0.1.3a1' README_FILENAME = 'README.rst' readme = open(os.path.join(os.path.dirname(__file__), README_FILENAME)) long_description = readme.read() readme.close() setup( name='django-cbv-formpreview', version=VERSION, author='Ry...
import os from setuptools import setup, find_packages VERSION = '0.2.0a1' README_FILENAME = 'README.rst' readme = open(os.path.join(os.path.dirname(__file__), README_FILENAME)) long_description = readme.read() readme.close() setup( name='django-cbv-formpreview', version=VERSION, author='Ryan Kaskel', ...
import os from setuptools import setup, find_packages VERSION = '0.1.3a1' README_FILENAME = 'README.rst' readme = open(os.path.join(os.path.dirname(__file__), README_FILENAME)) long_description = readme.read() readme.close() setup( name='django-cbv-formpreview', version=VERSION, author='Ryan Kaskel', ...
<commit_before>import os from setuptools import setup, find_packages VERSION = '0.1.3a1' README_FILENAME = 'README.rst' readme = open(os.path.join(os.path.dirname(__file__), README_FILENAME)) long_description = readme.read() readme.close() setup( name='django-cbv-formpreview', version=VERSION, author='Ry...
0bf7b654f1e1b6191e515e718911f027ea110ee3
setup.py
setup.py
# -*- coding: utf-8 -*- import os from setuptools import setup from setuptools.dist import Distribution with open(os.path.join(os.path.dirname(__file__), 'README')) as f: doc = f.read() class BinaryDistribution(Distribution): def is_pure(self): return False setup( name='json-stream', vers...
# -*- coding: utf-8 -*- import os from setuptools import setup from setuptools.dist import Distribution with open(os.path.join(os.path.dirname(__file__), 'README')) as f: doc = f.read() class BinaryDistribution(Distribution): def is_pure(self): return False setup( name='json-stream', vers...
Set URL to github one.
Set URL to github one.
Python
bsd-3-clause
fireteam/python-json-stream
# -*- coding: utf-8 -*- import os from setuptools import setup from setuptools.dist import Distribution with open(os.path.join(os.path.dirname(__file__), 'README')) as f: doc = f.read() class BinaryDistribution(Distribution): def is_pure(self): return False setup( name='json-stream', vers...
# -*- coding: utf-8 -*- import os from setuptools import setup from setuptools.dist import Distribution with open(os.path.join(os.path.dirname(__file__), 'README')) as f: doc = f.read() class BinaryDistribution(Distribution): def is_pure(self): return False setup( name='json-stream', vers...
<commit_before># -*- coding: utf-8 -*- import os from setuptools import setup from setuptools.dist import Distribution with open(os.path.join(os.path.dirname(__file__), 'README')) as f: doc = f.read() class BinaryDistribution(Distribution): def is_pure(self): return False setup( name='json-st...
# -*- coding: utf-8 -*- import os from setuptools import setup from setuptools.dist import Distribution with open(os.path.join(os.path.dirname(__file__), 'README')) as f: doc = f.read() class BinaryDistribution(Distribution): def is_pure(self): return False setup( name='json-stream', vers...
# -*- coding: utf-8 -*- import os from setuptools import setup from setuptools.dist import Distribution with open(os.path.join(os.path.dirname(__file__), 'README')) as f: doc = f.read() class BinaryDistribution(Distribution): def is_pure(self): return False setup( name='json-stream', vers...
<commit_before># -*- coding: utf-8 -*- import os from setuptools import setup from setuptools.dist import Distribution with open(os.path.join(os.path.dirname(__file__), 'README')) as f: doc = f.read() class BinaryDistribution(Distribution): def is_pure(self): return False setup( name='json-st...
8e9be2dedf41607c3928c8aa1f49a59989b3380a
setup.py
setup.py
from setuptools import setup, find_packages from lighthouse import __version__ classifiers = [] with open("classifiers.txt") as fd: classifiers = fd.readlines() setup( name="lighthouse", version=__version__, description="Service discovery tool focused on ease-of-use and resiliency", author="Wil...
from setuptools import setup, find_packages from lighthouse import __version__ classifiers = [] with open("classifiers.txt") as fd: classifiers = fd.readlines() setup( name="lighthouse", version=__version__, description="Service discovery tool focused on ease-of-use and resiliency", author="Wil...
Update balancers entry point to be coordinators.
Update balancers entry point to be coordinators.
Python
apache-2.0
wglass/lighthouse
from setuptools import setup, find_packages from lighthouse import __version__ classifiers = [] with open("classifiers.txt") as fd: classifiers = fd.readlines() setup( name="lighthouse", version=__version__, description="Service discovery tool focused on ease-of-use and resiliency", author="Wil...
from setuptools import setup, find_packages from lighthouse import __version__ classifiers = [] with open("classifiers.txt") as fd: classifiers = fd.readlines() setup( name="lighthouse", version=__version__, description="Service discovery tool focused on ease-of-use and resiliency", author="Wil...
<commit_before>from setuptools import setup, find_packages from lighthouse import __version__ classifiers = [] with open("classifiers.txt") as fd: classifiers = fd.readlines() setup( name="lighthouse", version=__version__, description="Service discovery tool focused on ease-of-use and resiliency", ...
from setuptools import setup, find_packages from lighthouse import __version__ classifiers = [] with open("classifiers.txt") as fd: classifiers = fd.readlines() setup( name="lighthouse", version=__version__, description="Service discovery tool focused on ease-of-use and resiliency", author="Wil...
from setuptools import setup, find_packages from lighthouse import __version__ classifiers = [] with open("classifiers.txt") as fd: classifiers = fd.readlines() setup( name="lighthouse", version=__version__, description="Service discovery tool focused on ease-of-use and resiliency", author="Wil...
<commit_before>from setuptools import setup, find_packages from lighthouse import __version__ classifiers = [] with open("classifiers.txt") as fd: classifiers = fd.readlines() setup( name="lighthouse", version=__version__, description="Service discovery tool focused on ease-of-use and resiliency", ...
9e548d0ac9bb953e4ecc27321d4455d27f653467
setup.py
setup.py
from setuptools import setup, find_packages setup( name='tangled.auth', version='0.1a2.dev0', description='Tangled auth integration', long_description=open('README.rst').read(), url='http://tangledframework.org/', author='Wyatt Baldwin', author_email='[email protected]', packages=f...
from setuptools import setup setup( name='tangled.auth', version='0.1a2.dev0', description='Tangled auth integration', long_description=open('README.rst').read(), url='http://tangledframework.org/', author='Wyatt Baldwin', author_email='[email protected]', packages=[ 'tangl...
Update package configuration, pt. ii
Update package configuration, pt. ii
Python
mit
TangledWeb/tangled.auth
from setuptools import setup, find_packages setup( name='tangled.auth', version='0.1a2.dev0', description='Tangled auth integration', long_description=open('README.rst').read(), url='http://tangledframework.org/', author='Wyatt Baldwin', author_email='[email protected]', packages=f...
from setuptools import setup setup( name='tangled.auth', version='0.1a2.dev0', description='Tangled auth integration', long_description=open('README.rst').read(), url='http://tangledframework.org/', author='Wyatt Baldwin', author_email='[email protected]', packages=[ 'tangl...
<commit_before>from setuptools import setup, find_packages setup( name='tangled.auth', version='0.1a2.dev0', description='Tangled auth integration', long_description=open('README.rst').read(), url='http://tangledframework.org/', author='Wyatt Baldwin', author_email='[email protected]',...
from setuptools import setup setup( name='tangled.auth', version='0.1a2.dev0', description='Tangled auth integration', long_description=open('README.rst').read(), url='http://tangledframework.org/', author='Wyatt Baldwin', author_email='[email protected]', packages=[ 'tangl...
from setuptools import setup, find_packages setup( name='tangled.auth', version='0.1a2.dev0', description='Tangled auth integration', long_description=open('README.rst').read(), url='http://tangledframework.org/', author='Wyatt Baldwin', author_email='[email protected]', packages=f...
<commit_before>from setuptools import setup, find_packages setup( name='tangled.auth', version='0.1a2.dev0', description='Tangled auth integration', long_description=open('README.rst').read(), url='http://tangledframework.org/', author='Wyatt Baldwin', author_email='[email protected]',...
f74f517a75fcf9f6858cc37823a19970cb27bd54
setup.py
setup.py
#!/usr/bin/env python import re from codecs import open from setuptools import setup with open('README.rst', encoding='utf8') as readme_file: readme = readme_file.read() with open('maxmindupdater/__init__.py', encoding='utf8') as init_py: metadata = dict(re.findall(r"__([a-z]+)__ = '([^']+)'", init_py.read())...
#!/usr/bin/env python import re from codecs import open from setuptools import setup with open('README.rst', encoding='utf8') as readme_file: readme = readme_file.read() with open('maxmindupdater/__init__.py', encoding='utf8') as init_py: metadata = dict(re.findall(r"__([a-z]+)__ = '([^']+)'", init_py.read())...
Include more general python classifiers for searchability
Include more general python classifiers for searchability
Python
mit
yola/maxmind-updater,yola/maxmind-updater
#!/usr/bin/env python import re from codecs import open from setuptools import setup with open('README.rst', encoding='utf8') as readme_file: readme = readme_file.read() with open('maxmindupdater/__init__.py', encoding='utf8') as init_py: metadata = dict(re.findall(r"__([a-z]+)__ = '([^']+)'", init_py.read())...
#!/usr/bin/env python import re from codecs import open from setuptools import setup with open('README.rst', encoding='utf8') as readme_file: readme = readme_file.read() with open('maxmindupdater/__init__.py', encoding='utf8') as init_py: metadata = dict(re.findall(r"__([a-z]+)__ = '([^']+)'", init_py.read())...
<commit_before>#!/usr/bin/env python import re from codecs import open from setuptools import setup with open('README.rst', encoding='utf8') as readme_file: readme = readme_file.read() with open('maxmindupdater/__init__.py', encoding='utf8') as init_py: metadata = dict(re.findall(r"__([a-z]+)__ = '([^']+)'", ...
#!/usr/bin/env python import re from codecs import open from setuptools import setup with open('README.rst', encoding='utf8') as readme_file: readme = readme_file.read() with open('maxmindupdater/__init__.py', encoding='utf8') as init_py: metadata = dict(re.findall(r"__([a-z]+)__ = '([^']+)'", init_py.read())...
#!/usr/bin/env python import re from codecs import open from setuptools import setup with open('README.rst', encoding='utf8') as readme_file: readme = readme_file.read() with open('maxmindupdater/__init__.py', encoding='utf8') as init_py: metadata = dict(re.findall(r"__([a-z]+)__ = '([^']+)'", init_py.read())...
<commit_before>#!/usr/bin/env python import re from codecs import open from setuptools import setup with open('README.rst', encoding='utf8') as readme_file: readme = readme_file.read() with open('maxmindupdater/__init__.py', encoding='utf8') as init_py: metadata = dict(re.findall(r"__([a-z]+)__ = '([^']+)'", ...
5ed918c6ff33ef2cda2f5548d2f27f9fcf7deaf7
setup.py
setup.py
# This Source Code Form is subject to the terms of the Mozilla Public # License, v. 2.0. If a copy of the MPL was not distributed with this file, # You can obtain one at http://mozilla.org/MPL/2.0/. from setuptools import setup PACKAGE_VERSION = '0.1' deps = ['fxos-appgen>=0.2.7', 'marionette_client>=0.7.1.1'...
# This Source Code Form is subject to the terms of the Mozilla Public # License, v. 2.0. If a copy of the MPL was not distributed with this file, # You can obtain one at http://mozilla.org/MPL/2.0/. from setuptools import setup PACKAGE_VERSION = '0.1' deps = ['fxos-appgen>=0.2.7', 'marionette_client>=0.7.1.1'...
Update required version of wptrunner
Update required version of wptrunner
Python
mpl-2.0
oouyang/fxos-certsuite,oouyang/fxos-certsuite,oouyang/fxos-certsuite,cr/fxos-certsuite,Conjuror/fxos-certsuite,oouyang/fxos-certsuite,Conjuror/fxos-certsuite,ShakoHo/fxos-certsuite,askeing/fxos-certsuite,ShakoHo/fxos-certsuite,ypwalter/fxos-certsuite,ypwalter/fxos-certsuite,cr/fxos-certsuite,cr/fxos-certsuite,cr/fxos-c...
# This Source Code Form is subject to the terms of the Mozilla Public # License, v. 2.0. If a copy of the MPL was not distributed with this file, # You can obtain one at http://mozilla.org/MPL/2.0/. from setuptools import setup PACKAGE_VERSION = '0.1' deps = ['fxos-appgen>=0.2.7', 'marionette_client>=0.7.1.1'...
# This Source Code Form is subject to the terms of the Mozilla Public # License, v. 2.0. If a copy of the MPL was not distributed with this file, # You can obtain one at http://mozilla.org/MPL/2.0/. from setuptools import setup PACKAGE_VERSION = '0.1' deps = ['fxos-appgen>=0.2.7', 'marionette_client>=0.7.1.1'...
<commit_before># This Source Code Form is subject to the terms of the Mozilla Public # License, v. 2.0. If a copy of the MPL was not distributed with this file, # You can obtain one at http://mozilla.org/MPL/2.0/. from setuptools import setup PACKAGE_VERSION = '0.1' deps = ['fxos-appgen>=0.2.7', 'marionette_c...
# This Source Code Form is subject to the terms of the Mozilla Public # License, v. 2.0. If a copy of the MPL was not distributed with this file, # You can obtain one at http://mozilla.org/MPL/2.0/. from setuptools import setup PACKAGE_VERSION = '0.1' deps = ['fxos-appgen>=0.2.7', 'marionette_client>=0.7.1.1'...
# This Source Code Form is subject to the terms of the Mozilla Public # License, v. 2.0. If a copy of the MPL was not distributed with this file, # You can obtain one at http://mozilla.org/MPL/2.0/. from setuptools import setup PACKAGE_VERSION = '0.1' deps = ['fxos-appgen>=0.2.7', 'marionette_client>=0.7.1.1'...
<commit_before># This Source Code Form is subject to the terms of the Mozilla Public # License, v. 2.0. If a copy of the MPL was not distributed with this file, # You can obtain one at http://mozilla.org/MPL/2.0/. from setuptools import setup PACKAGE_VERSION = '0.1' deps = ['fxos-appgen>=0.2.7', 'marionette_c...
d379bc510cac88434e9eb26a630e819870608b04
setup.py
setup.py
from setuptools import setup, find_packages setup( name='matmeta', version='0.1.0', url='https://github.com/jasonthiese/CommonMetadata', description='Common support for meta-data', author='Jason Thiese', author_email="[email protected]", license="Apache v2", packages=find_packages()...
from setuptools import setup, find_packages setup( name='matmeta', version='0.1.0', url='https://github.com/MaterialsDataInfrastructureConsortium/CommonMetadata', description='Common support for materials metadata', author='Jason Thiese', author_email="[email protected]", license="Apach...
Update the URL while we're at it
Update the URL while we're at it
Python
apache-2.0
MaterialsDataInfrastructureConsortium/CommonMetadata
from setuptools import setup, find_packages setup( name='matmeta', version='0.1.0', url='https://github.com/jasonthiese/CommonMetadata', description='Common support for meta-data', author='Jason Thiese', author_email="[email protected]", license="Apache v2", packages=find_packages()...
from setuptools import setup, find_packages setup( name='matmeta', version='0.1.0', url='https://github.com/MaterialsDataInfrastructureConsortium/CommonMetadata', description='Common support for materials metadata', author='Jason Thiese', author_email="[email protected]", license="Apach...
<commit_before>from setuptools import setup, find_packages setup( name='matmeta', version='0.1.0', url='https://github.com/jasonthiese/CommonMetadata', description='Common support for meta-data', author='Jason Thiese', author_email="[email protected]", license="Apache v2", packages=...
from setuptools import setup, find_packages setup( name='matmeta', version='0.1.0', url='https://github.com/MaterialsDataInfrastructureConsortium/CommonMetadata', description='Common support for materials metadata', author='Jason Thiese', author_email="[email protected]", license="Apach...
from setuptools import setup, find_packages setup( name='matmeta', version='0.1.0', url='https://github.com/jasonthiese/CommonMetadata', description='Common support for meta-data', author='Jason Thiese', author_email="[email protected]", license="Apache v2", packages=find_packages()...
<commit_before>from setuptools import setup, find_packages setup( name='matmeta', version='0.1.0', url='https://github.com/jasonthiese/CommonMetadata', description='Common support for meta-data', author='Jason Thiese', author_email="[email protected]", license="Apache v2", packages=...
63bc45d453759dbe27c8e39bfd521b985dfdaa30
setup.py
setup.py
# -*- coding: utf-8 -*- import pathlib from setuptools import setup def read(file_name): file_path = pathlib.Path(__file__).parent / file_name return file_path.read_text('utf-8') setup( name='cibopath', version='0.1.0', author='Raphael Pierzina', author_email='[email protected]', ma...
# -*- coding: utf-8 -*- import pathlib from setuptools import setup def read(file_name): file_path = pathlib.Path(__file__).parent / file_name return file_path.read_text('utf-8') setup( name='cibopath', version='0.1.0', author='Raphael Pierzina', author_email='[email protected]', ma...
Use all lower pypi keywords and add command-line
Use all lower pypi keywords and add command-line
Python
bsd-3-clause
hackebrot/cibopath
# -*- coding: utf-8 -*- import pathlib from setuptools import setup def read(file_name): file_path = pathlib.Path(__file__).parent / file_name return file_path.read_text('utf-8') setup( name='cibopath', version='0.1.0', author='Raphael Pierzina', author_email='[email protected]', ma...
# -*- coding: utf-8 -*- import pathlib from setuptools import setup def read(file_name): file_path = pathlib.Path(__file__).parent / file_name return file_path.read_text('utf-8') setup( name='cibopath', version='0.1.0', author='Raphael Pierzina', author_email='[email protected]', ma...
<commit_before># -*- coding: utf-8 -*- import pathlib from setuptools import setup def read(file_name): file_path = pathlib.Path(__file__).parent / file_name return file_path.read_text('utf-8') setup( name='cibopath', version='0.1.0', author='Raphael Pierzina', author_email='raphael@hackeb...
# -*- coding: utf-8 -*- import pathlib from setuptools import setup def read(file_name): file_path = pathlib.Path(__file__).parent / file_name return file_path.read_text('utf-8') setup( name='cibopath', version='0.1.0', author='Raphael Pierzina', author_email='[email protected]', ma...
# -*- coding: utf-8 -*- import pathlib from setuptools import setup def read(file_name): file_path = pathlib.Path(__file__).parent / file_name return file_path.read_text('utf-8') setup( name='cibopath', version='0.1.0', author='Raphael Pierzina', author_email='[email protected]', ma...
<commit_before># -*- coding: utf-8 -*- import pathlib from setuptools import setup def read(file_name): file_path = pathlib.Path(__file__).parent / file_name return file_path.read_text('utf-8') setup( name='cibopath', version='0.1.0', author='Raphael Pierzina', author_email='raphael@hackeb...
d34d8ff6ca7fa5c3a0171c6255292e1fac8647c8
setup.py
setup.py
#!/usr/bin/env python import os import skosprovider_oe try: from setuptools import setup except ImportError: from distutils.core import setup packages = [ 'skosprovider_oe', ] requires = [ 'skosprovider', 'requests>0.14,<0.14.99' ] setup( name='skosprovider_oe', version='0.1.0', de...
#!/usr/bin/env python import os import skosprovider_oe try: from setuptools import setup except ImportError: from distutils.core import setup packages = [ 'skosprovider_oe', ] requires = [ 'skosprovider', 'requests>=1.0.0' ] setup( name='skosprovider_oe', version='0.1.0', descripti...
Upgrade requests to versions > 1.0.0
Upgrade requests to versions > 1.0.0
Python
mit
koenedaele/skosprovider_oe
#!/usr/bin/env python import os import skosprovider_oe try: from setuptools import setup except ImportError: from distutils.core import setup packages = [ 'skosprovider_oe', ] requires = [ 'skosprovider', 'requests>0.14,<0.14.99' ] setup( name='skosprovider_oe', version='0.1.0', de...
#!/usr/bin/env python import os import skosprovider_oe try: from setuptools import setup except ImportError: from distutils.core import setup packages = [ 'skosprovider_oe', ] requires = [ 'skosprovider', 'requests>=1.0.0' ] setup( name='skosprovider_oe', version='0.1.0', descripti...
<commit_before>#!/usr/bin/env python import os import skosprovider_oe try: from setuptools import setup except ImportError: from distutils.core import setup packages = [ 'skosprovider_oe', ] requires = [ 'skosprovider', 'requests>0.14,<0.14.99' ] setup( name='skosprovider_oe', version=...
#!/usr/bin/env python import os import skosprovider_oe try: from setuptools import setup except ImportError: from distutils.core import setup packages = [ 'skosprovider_oe', ] requires = [ 'skosprovider', 'requests>=1.0.0' ] setup( name='skosprovider_oe', version='0.1.0', descripti...
#!/usr/bin/env python import os import skosprovider_oe try: from setuptools import setup except ImportError: from distutils.core import setup packages = [ 'skosprovider_oe', ] requires = [ 'skosprovider', 'requests>0.14,<0.14.99' ] setup( name='skosprovider_oe', version='0.1.0', de...
<commit_before>#!/usr/bin/env python import os import skosprovider_oe try: from setuptools import setup except ImportError: from distutils.core import setup packages = [ 'skosprovider_oe', ] requires = [ 'skosprovider', 'requests>0.14,<0.14.99' ] setup( name='skosprovider_oe', version=...
ded771f45dd8e196d53d892b40ac817912902746
setup.py
setup.py
from distutils.core import setup # Keeping all Python code for package in lib directory NAME = 'cplate' VERSION = '0.1' AUTHOR = 'Alexander W Blocker' AUTHOR_EMAIL = '[email protected]' URL = 'http://www.awblocker.com' DESCRIPTION = 'Probablistic deconvolution for chromatin-structure estimation.' REQUIRES = ['numpy(...
from distutils.core import setup # Keeping all Python code for package in lib directory NAME = 'cplate' VERSION = '0.1' AUTHOR = 'Alexander W Blocker' AUTHOR_EMAIL = '[email protected]' URL = 'https://www.github.com/awblocker/cplate' DESCRIPTION = 'Probabilistic deconvolution for chromatin-structure estimation.' REQ...
Update URL and fix typo in description.
Update URL and fix typo in description.
Python
apache-2.0
awblocker/cplate,awblocker/cplate
from distutils.core import setup # Keeping all Python code for package in lib directory NAME = 'cplate' VERSION = '0.1' AUTHOR = 'Alexander W Blocker' AUTHOR_EMAIL = '[email protected]' URL = 'http://www.awblocker.com' DESCRIPTION = 'Probablistic deconvolution for chromatin-structure estimation.' REQUIRES = ['numpy(...
from distutils.core import setup # Keeping all Python code for package in lib directory NAME = 'cplate' VERSION = '0.1' AUTHOR = 'Alexander W Blocker' AUTHOR_EMAIL = '[email protected]' URL = 'https://www.github.com/awblocker/cplate' DESCRIPTION = 'Probabilistic deconvolution for chromatin-structure estimation.' REQ...
<commit_before>from distutils.core import setup # Keeping all Python code for package in lib directory NAME = 'cplate' VERSION = '0.1' AUTHOR = 'Alexander W Blocker' AUTHOR_EMAIL = '[email protected]' URL = 'http://www.awblocker.com' DESCRIPTION = 'Probablistic deconvolution for chromatin-structure estimation.' REQU...
from distutils.core import setup # Keeping all Python code for package in lib directory NAME = 'cplate' VERSION = '0.1' AUTHOR = 'Alexander W Blocker' AUTHOR_EMAIL = '[email protected]' URL = 'https://www.github.com/awblocker/cplate' DESCRIPTION = 'Probabilistic deconvolution for chromatin-structure estimation.' REQ...
from distutils.core import setup # Keeping all Python code for package in lib directory NAME = 'cplate' VERSION = '0.1' AUTHOR = 'Alexander W Blocker' AUTHOR_EMAIL = '[email protected]' URL = 'http://www.awblocker.com' DESCRIPTION = 'Probablistic deconvolution for chromatin-structure estimation.' REQUIRES = ['numpy(...
<commit_before>from distutils.core import setup # Keeping all Python code for package in lib directory NAME = 'cplate' VERSION = '0.1' AUTHOR = 'Alexander W Blocker' AUTHOR_EMAIL = '[email protected]' URL = 'http://www.awblocker.com' DESCRIPTION = 'Probablistic deconvolution for chromatin-structure estimation.' REQU...
cc5d2aa34b4426a290e1807c6dee824a1d10fd73
setup.py
setup.py
import os from setuptools import setup, find_packages here = os.path.abspath(os.path.dirname(__file__)) README = open(os.path.join(here, 'README.rst')).read() CHANGES = open(os.path.join(here, 'CHANGES.rst')).read() requires = [ 'pyramid', 'cornice', 'colander', 'couchdb', ] test_requires = requ...
import os from setuptools import setup, find_packages here = os.path.abspath(os.path.dirname(__file__)) README = open(os.path.join(here, 'README.rst')).read() CHANGES = open(os.path.join(here, 'CHANGES.rst')).read() requires = [ 'pyramid', 'cornice', 'colander', 'couchdb', ] test_requires = requ...
Install the spore branch of cornice
Install the spore branch of cornice
Python
bsd-3-clause
spiral-project/daybed,spiral-project/daybed
import os from setuptools import setup, find_packages here = os.path.abspath(os.path.dirname(__file__)) README = open(os.path.join(here, 'README.rst')).read() CHANGES = open(os.path.join(here, 'CHANGES.rst')).read() requires = [ 'pyramid', 'cornice', 'colander', 'couchdb', ] test_requires = requ...
import os from setuptools import setup, find_packages here = os.path.abspath(os.path.dirname(__file__)) README = open(os.path.join(here, 'README.rst')).read() CHANGES = open(os.path.join(here, 'CHANGES.rst')).read() requires = [ 'pyramid', 'cornice', 'colander', 'couchdb', ] test_requires = requ...
<commit_before>import os from setuptools import setup, find_packages here = os.path.abspath(os.path.dirname(__file__)) README = open(os.path.join(here, 'README.rst')).read() CHANGES = open(os.path.join(here, 'CHANGES.rst')).read() requires = [ 'pyramid', 'cornice', 'colander', 'couchdb', ] test_...
import os from setuptools import setup, find_packages here = os.path.abspath(os.path.dirname(__file__)) README = open(os.path.join(here, 'README.rst')).read() CHANGES = open(os.path.join(here, 'CHANGES.rst')).read() requires = [ 'pyramid', 'cornice', 'colander', 'couchdb', ] test_requires = requ...
import os from setuptools import setup, find_packages here = os.path.abspath(os.path.dirname(__file__)) README = open(os.path.join(here, 'README.rst')).read() CHANGES = open(os.path.join(here, 'CHANGES.rst')).read() requires = [ 'pyramid', 'cornice', 'colander', 'couchdb', ] test_requires = requ...
<commit_before>import os from setuptools import setup, find_packages here = os.path.abspath(os.path.dirname(__file__)) README = open(os.path.join(here, 'README.rst')).read() CHANGES = open(os.path.join(here, 'CHANGES.rst')).read() requires = [ 'pyramid', 'cornice', 'colander', 'couchdb', ] test_...
dcb9850c854733a9e3686548c8e397d4b86c5e3d
setup.py
setup.py
from distutils.core import setup setup( name = 'brazilnum', packages = ['brazilnum'], version = '0.6.1', description = 'Validators for Brazilian CNPJ, CPF, and PIS/PASEP numbers.', author = 'Chris Poliquin', author_email = '[email protected]', url = 'https://gith...
from distutils.core import setup setup( name = 'brazilnum', packages = ['brazilnum'], version = '0.7.1', description = 'Validators for Brazilian CNPJ, CEI, CPF, and PIS/PASEP', author = 'Chris Poliquin', author_email = '[email protected]', url = 'https://github.c...
Add CEI to package description and bump version
Add CEI to package description and bump version
Python
mit
poliquin/brazilnum
from distutils.core import setup setup( name = 'brazilnum', packages = ['brazilnum'], version = '0.6.1', description = 'Validators for Brazilian CNPJ, CPF, and PIS/PASEP numbers.', author = 'Chris Poliquin', author_email = '[email protected]', url = 'https://gith...
from distutils.core import setup setup( name = 'brazilnum', packages = ['brazilnum'], version = '0.7.1', description = 'Validators for Brazilian CNPJ, CEI, CPF, and PIS/PASEP', author = 'Chris Poliquin', author_email = '[email protected]', url = 'https://github.c...
<commit_before>from distutils.core import setup setup( name = 'brazilnum', packages = ['brazilnum'], version = '0.6.1', description = 'Validators for Brazilian CNPJ, CPF, and PIS/PASEP numbers.', author = 'Chris Poliquin', author_email = '[email protected]', url ...
from distutils.core import setup setup( name = 'brazilnum', packages = ['brazilnum'], version = '0.7.1', description = 'Validators for Brazilian CNPJ, CEI, CPF, and PIS/PASEP', author = 'Chris Poliquin', author_email = '[email protected]', url = 'https://github.c...
from distutils.core import setup setup( name = 'brazilnum', packages = ['brazilnum'], version = '0.6.1', description = 'Validators for Brazilian CNPJ, CPF, and PIS/PASEP numbers.', author = 'Chris Poliquin', author_email = '[email protected]', url = 'https://gith...
<commit_before>from distutils.core import setup setup( name = 'brazilnum', packages = ['brazilnum'], version = '0.6.1', description = 'Validators for Brazilian CNPJ, CPF, and PIS/PASEP numbers.', author = 'Chris Poliquin', author_email = '[email protected]', url ...
225fd1163a50d4740afdeb21cb94e3f375016e9a
setup.py
setup.py
# -*- coding: utf-8 -*- import os from setuptools import setup import redis_shard def read_file(*path): base_dir = os.path.dirname(__file__) file_path = (base_dir, ) + tuple(path) return open(os.path.join(*file_path)).read() setup( name="redis-shard", url="https://pypi.python.org/pypi/redis-sha...
# -*- coding: utf-8 -*- import os from setuptools import setup import redis_shard def read_file(*path): base_dir = os.path.dirname(__file__) file_path = (base_dir, ) + tuple(path) return open(os.path.join(*file_path)).read() setup( name="redis-shard", url="https://pypi.python.org/pypi/redis-sha...
Update author and maintainer information
Update author and maintainer information
Python
bsd-2-clause
zhihu/redis-shard,keakon/redis-shard
# -*- coding: utf-8 -*- import os from setuptools import setup import redis_shard def read_file(*path): base_dir = os.path.dirname(__file__) file_path = (base_dir, ) + tuple(path) return open(os.path.join(*file_path)).read() setup( name="redis-shard", url="https://pypi.python.org/pypi/redis-sha...
# -*- coding: utf-8 -*- import os from setuptools import setup import redis_shard def read_file(*path): base_dir = os.path.dirname(__file__) file_path = (base_dir, ) + tuple(path) return open(os.path.join(*file_path)).read() setup( name="redis-shard", url="https://pypi.python.org/pypi/redis-sha...
<commit_before># -*- coding: utf-8 -*- import os from setuptools import setup import redis_shard def read_file(*path): base_dir = os.path.dirname(__file__) file_path = (base_dir, ) + tuple(path) return open(os.path.join(*file_path)).read() setup( name="redis-shard", url="https://pypi.python.org...
# -*- coding: utf-8 -*- import os from setuptools import setup import redis_shard def read_file(*path): base_dir = os.path.dirname(__file__) file_path = (base_dir, ) + tuple(path) return open(os.path.join(*file_path)).read() setup( name="redis-shard", url="https://pypi.python.org/pypi/redis-sha...
# -*- coding: utf-8 -*- import os from setuptools import setup import redis_shard def read_file(*path): base_dir = os.path.dirname(__file__) file_path = (base_dir, ) + tuple(path) return open(os.path.join(*file_path)).read() setup( name="redis-shard", url="https://pypi.python.org/pypi/redis-sha...
<commit_before># -*- coding: utf-8 -*- import os from setuptools import setup import redis_shard def read_file(*path): base_dir = os.path.dirname(__file__) file_path = (base_dir, ) + tuple(path) return open(os.path.join(*file_path)).read() setup( name="redis-shard", url="https://pypi.python.org...
5d62825d8a49d736496a3f53b3fe43f7a7fa8b09
setup.py
setup.py
from setuptools import setup datafiles = [('/etc', ['general_conf/bck.conf'])] setup( name='mysql-autoxtrabackup', version='1.1', packages=['general_conf', 'backup_prepare', 'partial_recovery', 'master_backup_script'], py_modules = ['autoxtrabackup'], url='https://github.com/ShahriyarR/MySQL-AutoX...
from setuptools import setup datafiles = [('/etc', ['general_conf/bck.conf'])] setup( name='mysql-autoxtrabackup', version='1.1', packages=['general_conf', 'backup_prepare', 'partial_recovery', 'master_backup_script'], py_modules = ['autoxtrabackup'], url='https://github.com/ShahriyarR/MySQL-AutoX...
Update requirements for correct mysql-connector name
Update requirements for correct mysql-connector name
Python
mit
ShahriyarR/MySQL-AutoXtraBackup,ShahriyarR/MySQL-AutoXtraBackup
from setuptools import setup datafiles = [('/etc', ['general_conf/bck.conf'])] setup( name='mysql-autoxtrabackup', version='1.1', packages=['general_conf', 'backup_prepare', 'partial_recovery', 'master_backup_script'], py_modules = ['autoxtrabackup'], url='https://github.com/ShahriyarR/MySQL-AutoX...
from setuptools import setup datafiles = [('/etc', ['general_conf/bck.conf'])] setup( name='mysql-autoxtrabackup', version='1.1', packages=['general_conf', 'backup_prepare', 'partial_recovery', 'master_backup_script'], py_modules = ['autoxtrabackup'], url='https://github.com/ShahriyarR/MySQL-AutoX...
<commit_before>from setuptools import setup datafiles = [('/etc', ['general_conf/bck.conf'])] setup( name='mysql-autoxtrabackup', version='1.1', packages=['general_conf', 'backup_prepare', 'partial_recovery', 'master_backup_script'], py_modules = ['autoxtrabackup'], url='https://github.com/Shahriy...
from setuptools import setup datafiles = [('/etc', ['general_conf/bck.conf'])] setup( name='mysql-autoxtrabackup', version='1.1', packages=['general_conf', 'backup_prepare', 'partial_recovery', 'master_backup_script'], py_modules = ['autoxtrabackup'], url='https://github.com/ShahriyarR/MySQL-AutoX...
from setuptools import setup datafiles = [('/etc', ['general_conf/bck.conf'])] setup( name='mysql-autoxtrabackup', version='1.1', packages=['general_conf', 'backup_prepare', 'partial_recovery', 'master_backup_script'], py_modules = ['autoxtrabackup'], url='https://github.com/ShahriyarR/MySQL-AutoX...
<commit_before>from setuptools import setup datafiles = [('/etc', ['general_conf/bck.conf'])] setup( name='mysql-autoxtrabackup', version='1.1', packages=['general_conf', 'backup_prepare', 'partial_recovery', 'master_backup_script'], py_modules = ['autoxtrabackup'], url='https://github.com/Shahriy...
fa49314b9a97f11bfbd668ae375cd257a59a444b
setup.py
setup.py
# python2.7 setup.py sdist from setuptools import setup setup( name='rpy2_helpers', description='Easier R use from Python', author='Ed L. Cashin', author_email='[email protected]', url='https://github.com/ecashin/rpy2_helpers', version='1.0', install_requires=[ 'click', 'n...
# python2.7 setup.py sdist from setuptools import setup setup( name='rpy2_helpers', description='Easier R use from Python', author='Ed L. Cashin', author_email='[email protected]', url='https://github.com/ecashin/rpy2_helpers', version='0.1', scripts = ['rpy2_helpers.py'], install_req...
Switch to a more descriptive version
Switch to a more descriptive version
Python
mit
ecashin/rpy2_helpers
# python2.7 setup.py sdist from setuptools import setup setup( name='rpy2_helpers', description='Easier R use from Python', author='Ed L. Cashin', author_email='[email protected]', url='https://github.com/ecashin/rpy2_helpers', version='1.0', install_requires=[ 'click', 'n...
# python2.7 setup.py sdist from setuptools import setup setup( name='rpy2_helpers', description='Easier R use from Python', author='Ed L. Cashin', author_email='[email protected]', url='https://github.com/ecashin/rpy2_helpers', version='0.1', scripts = ['rpy2_helpers.py'], install_req...
<commit_before># python2.7 setup.py sdist from setuptools import setup setup( name='rpy2_helpers', description='Easier R use from Python', author='Ed L. Cashin', author_email='[email protected]', url='https://github.com/ecashin/rpy2_helpers', version='1.0', install_requires=[ 'cli...
# python2.7 setup.py sdist from setuptools import setup setup( name='rpy2_helpers', description='Easier R use from Python', author='Ed L. Cashin', author_email='[email protected]', url='https://github.com/ecashin/rpy2_helpers', version='0.1', scripts = ['rpy2_helpers.py'], install_req...
# python2.7 setup.py sdist from setuptools import setup setup( name='rpy2_helpers', description='Easier R use from Python', author='Ed L. Cashin', author_email='[email protected]', url='https://github.com/ecashin/rpy2_helpers', version='1.0', install_requires=[ 'click', 'n...
<commit_before># python2.7 setup.py sdist from setuptools import setup setup( name='rpy2_helpers', description='Easier R use from Python', author='Ed L. Cashin', author_email='[email protected]', url='https://github.com/ecashin/rpy2_helpers', version='1.0', install_requires=[ 'cli...
566687fef24adaad5e86f1128d1e4e006d266553
setup.py
setup.py
from setuptools import setup, find_packages from suponoff import __version__ as version if __name__ == '__main__': with open("README.rst") as f: long_description = f.read() setup( name="suponoff", version=version, author="Gambit Research", author_email="info@gambitresea...
from setuptools import setup, find_packages from suponoff import __version__ as version if __name__ == '__main__': with open("README.rst") as f: long_description = f.read() setup( name="suponoff", version=version, author="Gambit Research", author_email="opensource@gambi...
Correct the author email address
Correct the author email address
Python
bsd-2-clause
GambitResearch/suponoff,lciti/suponoff,lciti/suponoff,GambitResearch/suponoff,GambitResearch/suponoff,lciti/suponoff
from setuptools import setup, find_packages from suponoff import __version__ as version if __name__ == '__main__': with open("README.rst") as f: long_description = f.read() setup( name="suponoff", version=version, author="Gambit Research", author_email="info@gambitresea...
from setuptools import setup, find_packages from suponoff import __version__ as version if __name__ == '__main__': with open("README.rst") as f: long_description = f.read() setup( name="suponoff", version=version, author="Gambit Research", author_email="opensource@gambi...
<commit_before>from setuptools import setup, find_packages from suponoff import __version__ as version if __name__ == '__main__': with open("README.rst") as f: long_description = f.read() setup( name="suponoff", version=version, author="Gambit Research", author_email="i...
from setuptools import setup, find_packages from suponoff import __version__ as version if __name__ == '__main__': with open("README.rst") as f: long_description = f.read() setup( name="suponoff", version=version, author="Gambit Research", author_email="opensource@gambi...
from setuptools import setup, find_packages from suponoff import __version__ as version if __name__ == '__main__': with open("README.rst") as f: long_description = f.read() setup( name="suponoff", version=version, author="Gambit Research", author_email="info@gambitresea...
<commit_before>from setuptools import setup, find_packages from suponoff import __version__ as version if __name__ == '__main__': with open("README.rst") as f: long_description = f.read() setup( name="suponoff", version=version, author="Gambit Research", author_email="i...
9dee9d6ba135ccba01ed4913b30a51a9ad9b326f
setup.py
setup.py
from setuptools import setup, find_packages setup( name='dict-utils', version='0.1', url='https://www.github.com/andreagrandi/dicts-utils/', author='Andrea Grandi', author_email='[email protected]', description='Simple framework for creating REST APIs', packages=find_packages(exclude=['tes...
from setuptools import setup, find_packages setup( name='dict-utils', version='0.1', url='https://www.github.com/andreagrandi/dict-utils/', author='Andrea Grandi', author_email='[email protected]', description='Set of utilities and accessory methods to work with Python dicts.', packages=fi...
Fix a typo and project description
Fix a typo and project description
Python
mit
glowdigitalmedia/dict-utils
from setuptools import setup, find_packages setup( name='dict-utils', version='0.1', url='https://www.github.com/andreagrandi/dicts-utils/', author='Andrea Grandi', author_email='[email protected]', description='Simple framework for creating REST APIs', packages=find_packages(exclude=['tes...
from setuptools import setup, find_packages setup( name='dict-utils', version='0.1', url='https://www.github.com/andreagrandi/dict-utils/', author='Andrea Grandi', author_email='[email protected]', description='Set of utilities and accessory methods to work with Python dicts.', packages=fi...
<commit_before>from setuptools import setup, find_packages setup( name='dict-utils', version='0.1', url='https://www.github.com/andreagrandi/dicts-utils/', author='Andrea Grandi', author_email='[email protected]', description='Simple framework for creating REST APIs', packages=find_package...
from setuptools import setup, find_packages setup( name='dict-utils', version='0.1', url='https://www.github.com/andreagrandi/dict-utils/', author='Andrea Grandi', author_email='[email protected]', description='Set of utilities and accessory methods to work with Python dicts.', packages=fi...
from setuptools import setup, find_packages setup( name='dict-utils', version='0.1', url='https://www.github.com/andreagrandi/dicts-utils/', author='Andrea Grandi', author_email='[email protected]', description='Simple framework for creating REST APIs', packages=find_packages(exclude=['tes...
<commit_before>from setuptools import setup, find_packages setup( name='dict-utils', version='0.1', url='https://www.github.com/andreagrandi/dicts-utils/', author='Andrea Grandi', author_email='[email protected]', description='Simple framework for creating REST APIs', packages=find_package...
cd8b8cca55572dfe8e3bf97976f70ee2d62b1323
setup.py
setup.py
from setuptools import setup, Extension module1 = Extension('earl', sources = ['earl.cpp']) setup ( name = "earl-etf", version = "2.0.2", description = "Earl-etf, the fanciest External Term Format packer and unpacker available for Python.", ext_modules = [module1], url="https://github.com/ccubed/Earl", author="...
from setuptools import setup, Extension module1 = Extension('earl', sources = ['earl.cpp']) setup ( name = "earl-etf", version = "2.1.2", description = "Earl-etf, the fanciest External Term Format packer and unpacker available for Python.", ext_modules = [module1], url="https://github.com/ccubed/Earl", author="...
Bump version and compile new wheels for pypy
Bump version and compile new wheels for pypy
Python
mit
ccubed/Earl,ccubed/Earl
from setuptools import setup, Extension module1 = Extension('earl', sources = ['earl.cpp']) setup ( name = "earl-etf", version = "2.0.2", description = "Earl-etf, the fanciest External Term Format packer and unpacker available for Python.", ext_modules = [module1], url="https://github.com/ccubed/Earl", author="...
from setuptools import setup, Extension module1 = Extension('earl', sources = ['earl.cpp']) setup ( name = "earl-etf", version = "2.1.2", description = "Earl-etf, the fanciest External Term Format packer and unpacker available for Python.", ext_modules = [module1], url="https://github.com/ccubed/Earl", author="...
<commit_before>from setuptools import setup, Extension module1 = Extension('earl', sources = ['earl.cpp']) setup ( name = "earl-etf", version = "2.0.2", description = "Earl-etf, the fanciest External Term Format packer and unpacker available for Python.", ext_modules = [module1], url="https://github.com/ccubed/E...
from setuptools import setup, Extension module1 = Extension('earl', sources = ['earl.cpp']) setup ( name = "earl-etf", version = "2.1.2", description = "Earl-etf, the fanciest External Term Format packer and unpacker available for Python.", ext_modules = [module1], url="https://github.com/ccubed/Earl", author="...
from setuptools import setup, Extension module1 = Extension('earl', sources = ['earl.cpp']) setup ( name = "earl-etf", version = "2.0.2", description = "Earl-etf, the fanciest External Term Format packer and unpacker available for Python.", ext_modules = [module1], url="https://github.com/ccubed/Earl", author="...
<commit_before>from setuptools import setup, Extension module1 = Extension('earl', sources = ['earl.cpp']) setup ( name = "earl-etf", version = "2.0.2", description = "Earl-etf, the fanciest External Term Format packer and unpacker available for Python.", ext_modules = [module1], url="https://github.com/ccubed/E...
b2e85641a87c647132cc8938b470c7bd9ddedb0b
setup.py
setup.py
#!/usr/bin/env python from setuptools import setup setup( name='mass', version='0.0.1', description='Watches your javascript', author='Jack Boberg & Alex Padgett', author_email='[email protected]', url='https://github.com/jackboberg/jswatchr', packages=['mass'], install_require...
#!/usr/bin/env python from setuptools import setup setup( name='mass', version='0.0.1', description='Watches your javascript', author='Jack Boberg & Alex Padgett', author_email='[email protected]', url='https://github.com/jackboberg/jswatchr', packages=['mass'], install_require...
Fix entry point reference to mass
Fix entry point reference to mass
Python
bsd-2-clause
coded-by-hand/mass,coded-by-hand/mass
#!/usr/bin/env python from setuptools import setup setup( name='mass', version='0.0.1', description='Watches your javascript', author='Jack Boberg & Alex Padgett', author_email='[email protected]', url='https://github.com/jackboberg/jswatchr', packages=['mass'], install_require...
#!/usr/bin/env python from setuptools import setup setup( name='mass', version='0.0.1', description='Watches your javascript', author='Jack Boberg & Alex Padgett', author_email='[email protected]', url='https://github.com/jackboberg/jswatchr', packages=['mass'], install_require...
<commit_before>#!/usr/bin/env python from setuptools import setup setup( name='mass', version='0.0.1', description='Watches your javascript', author='Jack Boberg & Alex Padgett', author_email='[email protected]', url='https://github.com/jackboberg/jswatchr', packages=['mass'], ...
#!/usr/bin/env python from setuptools import setup setup( name='mass', version='0.0.1', description='Watches your javascript', author='Jack Boberg & Alex Padgett', author_email='[email protected]', url='https://github.com/jackboberg/jswatchr', packages=['mass'], install_require...
#!/usr/bin/env python from setuptools import setup setup( name='mass', version='0.0.1', description='Watches your javascript', author='Jack Boberg & Alex Padgett', author_email='[email protected]', url='https://github.com/jackboberg/jswatchr', packages=['mass'], install_require...
<commit_before>#!/usr/bin/env python from setuptools import setup setup( name='mass', version='0.0.1', description='Watches your javascript', author='Jack Boberg & Alex Padgett', author_email='[email protected]', url='https://github.com/jackboberg/jswatchr', packages=['mass'], ...
9aebd808c50faa0ef7801bd5f9795d0dbffa1752
setup.py
setup.py
from distutils.core import setup import skyfield # to learn the version setup( name='skyfield', version=skyfield.__version__, description=skyfield.__doc__, long_description=open('README.rst').read(), license='MIT', author='Brandon Rhodes', author_email='[email protected]', url='ht...
from distutils.core import setup import skyfield # to learn the version setup( name='skyfield', version=skyfield.__version__, description=skyfield.__doc__, long_description=open('README.rst').read(), license='MIT', author='Brandon Rhodes', author_email='[email protected]', url='ht...
Include last data-cache build-date file in package
Include last data-cache build-date file in package
Python
mit
exoanalytic/python-skyfield,skyfielders/python-skyfield,ozialien/python-skyfield,skyfielders/python-skyfield,exoanalytic/python-skyfield,GuidoBR/python-skyfield,ozialien/python-skyfield,GuidoBR/python-skyfield
from distutils.core import setup import skyfield # to learn the version setup( name='skyfield', version=skyfield.__version__, description=skyfield.__doc__, long_description=open('README.rst').read(), license='MIT', author='Brandon Rhodes', author_email='[email protected]', url='ht...
from distutils.core import setup import skyfield # to learn the version setup( name='skyfield', version=skyfield.__version__, description=skyfield.__doc__, long_description=open('README.rst').read(), license='MIT', author='Brandon Rhodes', author_email='[email protected]', url='ht...
<commit_before>from distutils.core import setup import skyfield # to learn the version setup( name='skyfield', version=skyfield.__version__, description=skyfield.__doc__, long_description=open('README.rst').read(), license='MIT', author='Brandon Rhodes', author_email='[email protected]...
from distutils.core import setup import skyfield # to learn the version setup( name='skyfield', version=skyfield.__version__, description=skyfield.__doc__, long_description=open('README.rst').read(), license='MIT', author='Brandon Rhodes', author_email='[email protected]', url='ht...
from distutils.core import setup import skyfield # to learn the version setup( name='skyfield', version=skyfield.__version__, description=skyfield.__doc__, long_description=open('README.rst').read(), license='MIT', author='Brandon Rhodes', author_email='[email protected]', url='ht...
<commit_before>from distutils.core import setup import skyfield # to learn the version setup( name='skyfield', version=skyfield.__version__, description=skyfield.__doc__, long_description=open('README.rst').read(), license='MIT', author='Brandon Rhodes', author_email='[email protected]...
1b5f4e5777ddefa1124d665cdfc37d982f480f6b
setup.py
setup.py
#! /usr/bin/env python from setuptools import setup, Extension pyasmjit_module = Extension( 'pyasmjit.pyasmjit', sources = [ 'pyasmjit/pyasmjit.c' ], ) setup( author = 'Christian Heitman', author_email = '[email protected]', description = 'PyAsmJIT', ex...
#! /usr/bin/env python from setuptools import setup, Extension pyasmjit_module = Extension( 'pyasmjit.pyasmjit', sources = [ 'pyasmjit/pyasmjit.c' ], ) setup( author = 'Christian Heitman', author_email = '[email protected]', description = 'PyAsmJIT', ex...
Update README. Add global change log file. Update version number.
Update README. Add global change log file. Update version number.
Python
bsd-2-clause
programa-stic/pyasmjit,programa-stic/pyasmjit
#! /usr/bin/env python from setuptools import setup, Extension pyasmjit_module = Extension( 'pyasmjit.pyasmjit', sources = [ 'pyasmjit/pyasmjit.c' ], ) setup( author = 'Christian Heitman', author_email = '[email protected]', description = 'PyAsmJIT', ex...
#! /usr/bin/env python from setuptools import setup, Extension pyasmjit_module = Extension( 'pyasmjit.pyasmjit', sources = [ 'pyasmjit/pyasmjit.c' ], ) setup( author = 'Christian Heitman', author_email = '[email protected]', description = 'PyAsmJIT', ex...
<commit_before>#! /usr/bin/env python from setuptools import setup, Extension pyasmjit_module = Extension( 'pyasmjit.pyasmjit', sources = [ 'pyasmjit/pyasmjit.c' ], ) setup( author = 'Christian Heitman', author_email = '[email protected]', description = 'Py...
#! /usr/bin/env python from setuptools import setup, Extension pyasmjit_module = Extension( 'pyasmjit.pyasmjit', sources = [ 'pyasmjit/pyasmjit.c' ], ) setup( author = 'Christian Heitman', author_email = '[email protected]', description = 'PyAsmJIT', ex...
#! /usr/bin/env python from setuptools import setup, Extension pyasmjit_module = Extension( 'pyasmjit.pyasmjit', sources = [ 'pyasmjit/pyasmjit.c' ], ) setup( author = 'Christian Heitman', author_email = '[email protected]', description = 'PyAsmJIT', ex...
<commit_before>#! /usr/bin/env python from setuptools import setup, Extension pyasmjit_module = Extension( 'pyasmjit.pyasmjit', sources = [ 'pyasmjit/pyasmjit.c' ], ) setup( author = 'Christian Heitman', author_email = '[email protected]', description = 'Py...
464b859aa48530190639077fe528d7d2be2961ce
setup.py
setup.py
#!/usr/bin/env python try: from setuptools import setup, find_packages except ImportError: from ez_setup import use_setuptools use_setuptools() from setuptools import setup, find_packages setup( name='Mooch Sentinel', version='0.0.1', description="Keep you from mooching unless chores are do...
#!/usr/bin/env python try: from setuptools import setup, find_packages except ImportError: from ez_setup import use_setuptools use_setuptools() from setuptools import setup, find_packages setup( name='Mooch Sentinel', version='0.0.1', description="Keep you from mooching unless chores are do...
Add dependencies on `requests` and `BeautifulSoup`
Add dependencies on `requests` and `BeautifulSoup`
Python
mit
asivokon/mooch-sentinel,asivokon/mooch-sentinel,asivokon/mooch-sentinel,asivokon/mooch-sentinel
#!/usr/bin/env python try: from setuptools import setup, find_packages except ImportError: from ez_setup import use_setuptools use_setuptools() from setuptools import setup, find_packages setup( name='Mooch Sentinel', version='0.0.1', description="Keep you from mooching unless chores are do...
#!/usr/bin/env python try: from setuptools import setup, find_packages except ImportError: from ez_setup import use_setuptools use_setuptools() from setuptools import setup, find_packages setup( name='Mooch Sentinel', version='0.0.1', description="Keep you from mooching unless chores are do...
<commit_before>#!/usr/bin/env python try: from setuptools import setup, find_packages except ImportError: from ez_setup import use_setuptools use_setuptools() from setuptools import setup, find_packages setup( name='Mooch Sentinel', version='0.0.1', description="Keep you from mooching unles...
#!/usr/bin/env python try: from setuptools import setup, find_packages except ImportError: from ez_setup import use_setuptools use_setuptools() from setuptools import setup, find_packages setup( name='Mooch Sentinel', version='0.0.1', description="Keep you from mooching unless chores are do...
#!/usr/bin/env python try: from setuptools import setup, find_packages except ImportError: from ez_setup import use_setuptools use_setuptools() from setuptools import setup, find_packages setup( name='Mooch Sentinel', version='0.0.1', description="Keep you from mooching unless chores are do...
<commit_before>#!/usr/bin/env python try: from setuptools import setup, find_packages except ImportError: from ez_setup import use_setuptools use_setuptools() from setuptools import setup, find_packages setup( name='Mooch Sentinel', version='0.0.1', description="Keep you from mooching unles...
bf5c3c0a9409115d4e743d9b53d3de2803937901
setup.py
setup.py
from setuptools import setup from setuptools.command.test import test as TestCommand import sys class Tox(TestCommand): user_options = [('tox-args=', 'a', "Arguments to pass to tox")] def initialize_options(self): TestCommand.initialize_options(self) self.tox_args = None def finalize_option...
from setuptools import setup from setuptools.command.test import test as TestCommand import sys class Tox(TestCommand): user_options = [('tox-args=', 'a', "Arguments to pass to tox")] def initialize_options(self): TestCommand.initialize_options(self) self.tox_args = None def finalize_option...
Allow package to be installed as an egg
Allow package to be installed as an egg
Python
mit
noahgoldman/adbpy
from setuptools import setup from setuptools.command.test import test as TestCommand import sys class Tox(TestCommand): user_options = [('tox-args=', 'a', "Arguments to pass to tox")] def initialize_options(self): TestCommand.initialize_options(self) self.tox_args = None def finalize_option...
from setuptools import setup from setuptools.command.test import test as TestCommand import sys class Tox(TestCommand): user_options = [('tox-args=', 'a', "Arguments to pass to tox")] def initialize_options(self): TestCommand.initialize_options(self) self.tox_args = None def finalize_option...
<commit_before>from setuptools import setup from setuptools.command.test import test as TestCommand import sys class Tox(TestCommand): user_options = [('tox-args=', 'a', "Arguments to pass to tox")] def initialize_options(self): TestCommand.initialize_options(self) self.tox_args = None def ...
from setuptools import setup from setuptools.command.test import test as TestCommand import sys class Tox(TestCommand): user_options = [('tox-args=', 'a', "Arguments to pass to tox")] def initialize_options(self): TestCommand.initialize_options(self) self.tox_args = None def finalize_option...
from setuptools import setup from setuptools.command.test import test as TestCommand import sys class Tox(TestCommand): user_options = [('tox-args=', 'a', "Arguments to pass to tox")] def initialize_options(self): TestCommand.initialize_options(self) self.tox_args = None def finalize_option...
<commit_before>from setuptools import setup from setuptools.command.test import test as TestCommand import sys class Tox(TestCommand): user_options = [('tox-args=', 'a', "Arguments to pass to tox")] def initialize_options(self): TestCommand.initialize_options(self) self.tox_args = None def ...
c23862a1c607eb0b9ee58f3826a958453426d097
setup.py
setup.py
#!/usr/bin/env python from setuptools import setup, find_packages setup( name="txyam2", version="0.5", description="Yet Another Memcached (YAM) client for Twisted.", author="Brian Muller", author_email="[email protected]", license="MIT", url="http://github.com/bmuller/txyam", packages=...
#!/usr/bin/env python from setuptools import setup, find_packages setup( name="txyam2", version="0.5", description="Yet Another Memcached (YAM) client for Twisted.", author="Brian Muller", author_email="[email protected]", license="MIT", url="http://github.com/bmuller/txyam", packages=...
Add extras for the sync client.
Add extras for the sync client.
Python
mit
Weasyl/txyam2
#!/usr/bin/env python from setuptools import setup, find_packages setup( name="txyam2", version="0.5", description="Yet Another Memcached (YAM) client for Twisted.", author="Brian Muller", author_email="[email protected]", license="MIT", url="http://github.com/bmuller/txyam", packages=...
#!/usr/bin/env python from setuptools import setup, find_packages setup( name="txyam2", version="0.5", description="Yet Another Memcached (YAM) client for Twisted.", author="Brian Muller", author_email="[email protected]", license="MIT", url="http://github.com/bmuller/txyam", packages=...
<commit_before>#!/usr/bin/env python from setuptools import setup, find_packages setup( name="txyam2", version="0.5", description="Yet Another Memcached (YAM) client for Twisted.", author="Brian Muller", author_email="[email protected]", license="MIT", url="http://github.com/bmuller/txyam"...
#!/usr/bin/env python from setuptools import setup, find_packages setup( name="txyam2", version="0.5", description="Yet Another Memcached (YAM) client for Twisted.", author="Brian Muller", author_email="[email protected]", license="MIT", url="http://github.com/bmuller/txyam", packages=...
#!/usr/bin/env python from setuptools import setup, find_packages setup( name="txyam2", version="0.5", description="Yet Another Memcached (YAM) client for Twisted.", author="Brian Muller", author_email="[email protected]", license="MIT", url="http://github.com/bmuller/txyam", packages=...
<commit_before>#!/usr/bin/env python from setuptools import setup, find_packages setup( name="txyam2", version="0.5", description="Yet Another Memcached (YAM) client for Twisted.", author="Brian Muller", author_email="[email protected]", license="MIT", url="http://github.com/bmuller/txyam"...
37cca32b8fd54d4b98a19c054c48964a5bcac40c
setup.py
setup.py
#!/usr/bin/env python from setuptools import setup, find_packages setup( name = "django-dummyimage", version = "0.1.1", description = "Dynamic Dummy Image Generator For Django!", author = "Rolando Espinoza La fuente", author_email = "[email protected]", url = "https://github.com/darkrho/django-...
#!/usr/bin/env python from setuptools import setup, find_packages setup( name = "django-dummyimage", version = "0.1.1", description = "Dynamic Dummy Image Generator For Django!", author = "Rolando Espinoza La fuente", author_email = "[email protected]", url = "https://github.com/darkrho/django-...
Use Pillow instead of PIL
Use Pillow instead of PIL
Python
bsd-3-clause
trik/django-dummyimage,11craft/django-dummyimage
#!/usr/bin/env python from setuptools import setup, find_packages setup( name = "django-dummyimage", version = "0.1.1", description = "Dynamic Dummy Image Generator For Django!", author = "Rolando Espinoza La fuente", author_email = "[email protected]", url = "https://github.com/darkrho/django-...
#!/usr/bin/env python from setuptools import setup, find_packages setup( name = "django-dummyimage", version = "0.1.1", description = "Dynamic Dummy Image Generator For Django!", author = "Rolando Espinoza La fuente", author_email = "[email protected]", url = "https://github.com/darkrho/django-...
<commit_before>#!/usr/bin/env python from setuptools import setup, find_packages setup( name = "django-dummyimage", version = "0.1.1", description = "Dynamic Dummy Image Generator For Django!", author = "Rolando Espinoza La fuente", author_email = "[email protected]", url = "https://github.com/...
#!/usr/bin/env python from setuptools import setup, find_packages setup( name = "django-dummyimage", version = "0.1.1", description = "Dynamic Dummy Image Generator For Django!", author = "Rolando Espinoza La fuente", author_email = "[email protected]", url = "https://github.com/darkrho/django-...
#!/usr/bin/env python from setuptools import setup, find_packages setup( name = "django-dummyimage", version = "0.1.1", description = "Dynamic Dummy Image Generator For Django!", author = "Rolando Espinoza La fuente", author_email = "[email protected]", url = "https://github.com/darkrho/django-...
<commit_before>#!/usr/bin/env python from setuptools import setup, find_packages setup( name = "django-dummyimage", version = "0.1.1", description = "Dynamic Dummy Image Generator For Django!", author = "Rolando Espinoza La fuente", author_email = "[email protected]", url = "https://github.com/...
2202ecfafb085dbbaa1e2db1423b9d6f98f5f471
stack.py
stack.py
class StackItem(object): def __init__(self, data, next_item=None): self.data = data self.next_item = next_item def __str__(self): return self.data class StackFrame(object): def __init__(self, first_item=None): self.first_item = first_item def push(self, new_item): ...
class StackItem(object): def __init__(self, data, next_item=None): self.data = data self.next_item = next_item def __str__(self): return self.data class StackFrame(object): def __init__(self, first_item=None): self.first_item = first_item def push(self, new_item): ...
Fix pop to raise ValueError when empty Stack is popped
Fix pop to raise ValueError when empty Stack is popped
Python
mit
jwarren116/data-structures
class StackItem(object): def __init__(self, data, next_item=None): self.data = data self.next_item = next_item def __str__(self): return self.data class StackFrame(object): def __init__(self, first_item=None): self.first_item = first_item def push(self, new_item): ...
class StackItem(object): def __init__(self, data, next_item=None): self.data = data self.next_item = next_item def __str__(self): return self.data class StackFrame(object): def __init__(self, first_item=None): self.first_item = first_item def push(self, new_item): ...
<commit_before>class StackItem(object): def __init__(self, data, next_item=None): self.data = data self.next_item = next_item def __str__(self): return self.data class StackFrame(object): def __init__(self, first_item=None): self.first_item = first_item def push(self,...
class StackItem(object): def __init__(self, data, next_item=None): self.data = data self.next_item = next_item def __str__(self): return self.data class StackFrame(object): def __init__(self, first_item=None): self.first_item = first_item def push(self, new_item): ...
class StackItem(object): def __init__(self, data, next_item=None): self.data = data self.next_item = next_item def __str__(self): return self.data class StackFrame(object): def __init__(self, first_item=None): self.first_item = first_item def push(self, new_item): ...
<commit_before>class StackItem(object): def __init__(self, data, next_item=None): self.data = data self.next_item = next_item def __str__(self): return self.data class StackFrame(object): def __init__(self, first_item=None): self.first_item = first_item def push(self,...
fd6572b9910e0c5a01cbe1376f15059d80cf5093
all/templates/init.py
all/templates/init.py
from flask import Flask, url_for import os <%= appName %> = Flask(__name__) # Determines the destination of the build. Only usefull if you're using Frozen-Flask <%= appName %>.config['FREEZER_DESTINATION'] = os.path.dirname(os.path.abspath(__file__))+'/../build' # Function to easily find your assets # In your templa...
from flask import Flask, url_for import os <%= appName %> = Flask(__name__) # Determines the destination of the build. Only usefull if you're using Frozen-Flask <%= appName %>.config['FREEZER_DESTINATION'] = os.path.dirname(os.path.abspath(__file__))+'/../build' # Function to easily find your assets # In your templa...
Replace hardcoded "app" with parameter "appName"
Replace hardcoded "app" with parameter "appName"
Python
mit
romainberger/yeoman-flask,romainberger/yeoman-flask
from flask import Flask, url_for import os <%= appName %> = Flask(__name__) # Determines the destination of the build. Only usefull if you're using Frozen-Flask <%= appName %>.config['FREEZER_DESTINATION'] = os.path.dirname(os.path.abspath(__file__))+'/../build' # Function to easily find your assets # In your templa...
from flask import Flask, url_for import os <%= appName %> = Flask(__name__) # Determines the destination of the build. Only usefull if you're using Frozen-Flask <%= appName %>.config['FREEZER_DESTINATION'] = os.path.dirname(os.path.abspath(__file__))+'/../build' # Function to easily find your assets # In your templa...
<commit_before>from flask import Flask, url_for import os <%= appName %> = Flask(__name__) # Determines the destination of the build. Only usefull if you're using Frozen-Flask <%= appName %>.config['FREEZER_DESTINATION'] = os.path.dirname(os.path.abspath(__file__))+'/../build' # Function to easily find your assets #...
from flask import Flask, url_for import os <%= appName %> = Flask(__name__) # Determines the destination of the build. Only usefull if you're using Frozen-Flask <%= appName %>.config['FREEZER_DESTINATION'] = os.path.dirname(os.path.abspath(__file__))+'/../build' # Function to easily find your assets # In your templa...
from flask import Flask, url_for import os <%= appName %> = Flask(__name__) # Determines the destination of the build. Only usefull if you're using Frozen-Flask <%= appName %>.config['FREEZER_DESTINATION'] = os.path.dirname(os.path.abspath(__file__))+'/../build' # Function to easily find your assets # In your templa...
<commit_before>from flask import Flask, url_for import os <%= appName %> = Flask(__name__) # Determines the destination of the build. Only usefull if you're using Frozen-Flask <%= appName %>.config['FREEZER_DESTINATION'] = os.path.dirname(os.path.abspath(__file__))+'/../build' # Function to easily find your assets #...
47d950b882c01820db7fe99431526487d88622db
tasks.py
tasks.py
import os from invocations.docs import docs, www, sites, watch_docs from invocations.testing import test, coverage, integration, watch_tests from invocations.packaging import vendorize, release from invoke import Collection from invoke.util import LOG_FORMAT ns = Collection( test, coverage, integration, vendori...
import os from invocations.docs import docs, www, sites, watch_docs from invocations.testing import test, coverage, integration, watch_tests from invocations.packaging import vendorize, release from invoke import Collection from invoke.util import LOG_FORMAT ns = Collection( test, coverage, integration, vendori...
Check setup.py desc when packaging
Check setup.py desc when packaging
Python
bsd-2-clause
pyinvoke/invoke,pyinvoke/invoke,mkusz/invoke,mkusz/invoke
import os from invocations.docs import docs, www, sites, watch_docs from invocations.testing import test, coverage, integration, watch_tests from invocations.packaging import vendorize, release from invoke import Collection from invoke.util import LOG_FORMAT ns = Collection( test, coverage, integration, vendori...
import os from invocations.docs import docs, www, sites, watch_docs from invocations.testing import test, coverage, integration, watch_tests from invocations.packaging import vendorize, release from invoke import Collection from invoke.util import LOG_FORMAT ns = Collection( test, coverage, integration, vendori...
<commit_before>import os from invocations.docs import docs, www, sites, watch_docs from invocations.testing import test, coverage, integration, watch_tests from invocations.packaging import vendorize, release from invoke import Collection from invoke.util import LOG_FORMAT ns = Collection( test, coverage, integ...
import os from invocations.docs import docs, www, sites, watch_docs from invocations.testing import test, coverage, integration, watch_tests from invocations.packaging import vendorize, release from invoke import Collection from invoke.util import LOG_FORMAT ns = Collection( test, coverage, integration, vendori...
import os from invocations.docs import docs, www, sites, watch_docs from invocations.testing import test, coverage, integration, watch_tests from invocations.packaging import vendorize, release from invoke import Collection from invoke.util import LOG_FORMAT ns = Collection( test, coverage, integration, vendori...
<commit_before>import os from invocations.docs import docs, www, sites, watch_docs from invocations.testing import test, coverage, integration, watch_tests from invocations.packaging import vendorize, release from invoke import Collection from invoke.util import LOG_FORMAT ns = Collection( test, coverage, integ...
30709e0a8f5392260543b9d0fb168a3246d827ad
tasks.py
tasks.py
import invoke # Based on https://github.com/pyca/cryptography/blob/master/tasks.py @invoke.task def release(version): invoke.run("git tag -a release-{0} -m \"Tagged {0} release\"".format(version)) invoke.run("git push --tags") invoke.run("python setup.py sdist") invoke.run("twine upload dist/pyuv-{...
import invoke # Based on https://github.com/pyca/cryptography/blob/master/tasks.py @invoke.task def release(version): invoke.run("git tag -a pyuv-{0} -m \"pyuv {0} release\"".format(version)) invoke.run("git push --tags") invoke.run("python setup.py sdist") invoke.run("twine upload dist/pyuv-{0}*"....
Fix tag names so GitHub generates better filenames
Fix tag names so GitHub generates better filenames
Python
mit
saghul/pyuv,fivejjs/pyuv,fivejjs/pyuv,fivejjs/pyuv,saghul/pyuv,saghul/pyuv
import invoke # Based on https://github.com/pyca/cryptography/blob/master/tasks.py @invoke.task def release(version): invoke.run("git tag -a release-{0} -m \"Tagged {0} release\"".format(version)) invoke.run("git push --tags") invoke.run("python setup.py sdist") invoke.run("twine upload dist/pyuv-{...
import invoke # Based on https://github.com/pyca/cryptography/blob/master/tasks.py @invoke.task def release(version): invoke.run("git tag -a pyuv-{0} -m \"pyuv {0} release\"".format(version)) invoke.run("git push --tags") invoke.run("python setup.py sdist") invoke.run("twine upload dist/pyuv-{0}*"....
<commit_before> import invoke # Based on https://github.com/pyca/cryptography/blob/master/tasks.py @invoke.task def release(version): invoke.run("git tag -a release-{0} -m \"Tagged {0} release\"".format(version)) invoke.run("git push --tags") invoke.run("python setup.py sdist") invoke.run("twine upl...
import invoke # Based on https://github.com/pyca/cryptography/blob/master/tasks.py @invoke.task def release(version): invoke.run("git tag -a pyuv-{0} -m \"pyuv {0} release\"".format(version)) invoke.run("git push --tags") invoke.run("python setup.py sdist") invoke.run("twine upload dist/pyuv-{0}*"....
import invoke # Based on https://github.com/pyca/cryptography/blob/master/tasks.py @invoke.task def release(version): invoke.run("git tag -a release-{0} -m \"Tagged {0} release\"".format(version)) invoke.run("git push --tags") invoke.run("python setup.py sdist") invoke.run("twine upload dist/pyuv-{...
<commit_before> import invoke # Based on https://github.com/pyca/cryptography/blob/master/tasks.py @invoke.task def release(version): invoke.run("git tag -a release-{0} -m \"Tagged {0} release\"".format(version)) invoke.run("git push --tags") invoke.run("python setup.py sdist") invoke.run("twine upl...
15e4efdaa843ac5428e46d7d1566e9ef5acfaf9c
tmaps/defaultconfig.py
tmaps/defaultconfig.py
import logging import datetime DEBUG = True # Override this key with a secret one SECRET_KEY = 'default_secret_key' HASHIDS_SALT = 'default_secret_salt' ## Authentication JWT_EXPIRATION_DELTA = datetime.timedelta(days=2) JWT_NOT_BEFORE_DELTA = datetime.timedelta(seconds=0) ## Database SQLALCHEMY_DATABASE_URI = None...
import logging import datetime DEBUG = False # Override this key with a secret one SECRET_KEY = 'default_secret_key' HASHIDS_SALT = 'default_secret_salt' ## Authentication JWT_EXPIRATION_DELTA = datetime.timedelta(days=2) JWT_NOT_BEFORE_DELTA = datetime.timedelta(seconds=0) ## Database SQLALCHEMY_DATABASE_URI = Non...
Remove spark settings from default config file
Remove spark settings from default config file
Python
agpl-3.0
TissueMAPS/TmServer
import logging import datetime DEBUG = True # Override this key with a secret one SECRET_KEY = 'default_secret_key' HASHIDS_SALT = 'default_secret_salt' ## Authentication JWT_EXPIRATION_DELTA = datetime.timedelta(days=2) JWT_NOT_BEFORE_DELTA = datetime.timedelta(seconds=0) ## Database SQLALCHEMY_DATABASE_URI = None...
import logging import datetime DEBUG = False # Override this key with a secret one SECRET_KEY = 'default_secret_key' HASHIDS_SALT = 'default_secret_salt' ## Authentication JWT_EXPIRATION_DELTA = datetime.timedelta(days=2) JWT_NOT_BEFORE_DELTA = datetime.timedelta(seconds=0) ## Database SQLALCHEMY_DATABASE_URI = Non...
<commit_before>import logging import datetime DEBUG = True # Override this key with a secret one SECRET_KEY = 'default_secret_key' HASHIDS_SALT = 'default_secret_salt' ## Authentication JWT_EXPIRATION_DELTA = datetime.timedelta(days=2) JWT_NOT_BEFORE_DELTA = datetime.timedelta(seconds=0) ## Database SQLALCHEMY_DATA...
import logging import datetime DEBUG = False # Override this key with a secret one SECRET_KEY = 'default_secret_key' HASHIDS_SALT = 'default_secret_salt' ## Authentication JWT_EXPIRATION_DELTA = datetime.timedelta(days=2) JWT_NOT_BEFORE_DELTA = datetime.timedelta(seconds=0) ## Database SQLALCHEMY_DATABASE_URI = Non...
import logging import datetime DEBUG = True # Override this key with a secret one SECRET_KEY = 'default_secret_key' HASHIDS_SALT = 'default_secret_salt' ## Authentication JWT_EXPIRATION_DELTA = datetime.timedelta(days=2) JWT_NOT_BEFORE_DELTA = datetime.timedelta(seconds=0) ## Database SQLALCHEMY_DATABASE_URI = None...
<commit_before>import logging import datetime DEBUG = True # Override this key with a secret one SECRET_KEY = 'default_secret_key' HASHIDS_SALT = 'default_secret_salt' ## Authentication JWT_EXPIRATION_DELTA = datetime.timedelta(days=2) JWT_NOT_BEFORE_DELTA = datetime.timedelta(seconds=0) ## Database SQLALCHEMY_DATA...
fe033ea76c8dcc5a90b0ba28c2c851b4ebb3ed15
src/clients/lib/python/xmmsclient/propdict.py
src/clients/lib/python/xmmsclient/propdict.py
class PropDict(dict): def __init__(self, srcs): dict.__init__(self) self._sources = srcs def set_source_preference(self, sources): """ Change list of source preference This method has been deprecated and should no longer be used. """ raise DeprecationWarn...
class PropDict(dict): def __init__(self, srcs): dict.__init__(self) self._sources = srcs def set_source_preference(self, sources): """ Change list of source preference This method has been deprecated and should no longer be used. """ raise DeprecationWarn...
Allow PropDict.sources in python bindings to be any sequence.
BUG(1900): Allow PropDict.sources in python bindings to be any sequence.
Python
lgpl-2.1
mantaraya36/xmms2-mantaraya36,theeternalsw0rd/xmms2,mantaraya36/xmms2-mantaraya36,dreamerc/xmms2,chrippa/xmms2,mantaraya36/xmms2-mantaraya36,krad-radio/xmms2-krad,krad-radio/xmms2-krad,chrippa/xmms2,oneman/xmms2-oneman-old,six600110/xmms2,krad-radio/xmms2-krad,six600110/xmms2,theeternalsw0rd/xmms2,chrippa/xmms2,oneman/...
class PropDict(dict): def __init__(self, srcs): dict.__init__(self) self._sources = srcs def set_source_preference(self, sources): """ Change list of source preference This method has been deprecated and should no longer be used. """ raise DeprecationWarn...
class PropDict(dict): def __init__(self, srcs): dict.__init__(self) self._sources = srcs def set_source_preference(self, sources): """ Change list of source preference This method has been deprecated and should no longer be used. """ raise DeprecationWarn...
<commit_before>class PropDict(dict): def __init__(self, srcs): dict.__init__(self) self._sources = srcs def set_source_preference(self, sources): """ Change list of source preference This method has been deprecated and should no longer be used. """ raise ...
class PropDict(dict): def __init__(self, srcs): dict.__init__(self) self._sources = srcs def set_source_preference(self, sources): """ Change list of source preference This method has been deprecated and should no longer be used. """ raise DeprecationWarn...
class PropDict(dict): def __init__(self, srcs): dict.__init__(self) self._sources = srcs def set_source_preference(self, sources): """ Change list of source preference This method has been deprecated and should no longer be used. """ raise DeprecationWarn...
<commit_before>class PropDict(dict): def __init__(self, srcs): dict.__init__(self) self._sources = srcs def set_source_preference(self, sources): """ Change list of source preference This method has been deprecated and should no longer be used. """ raise ...
f90d4f61a4474fcff19187f81769f29b123d5765
tomviz/python/setup.py
tomviz/python/setup.py
from setuptools import setup, find_packages setup( name='tomviz-external', version='0.0.1', description='Tomviz python external execution infrastructure.', author='Kitware, Inc.', author_email='[email protected]', url='https://www.tomviz.org/', license='BSD 3-Clause', classifiers=[ ...
from setuptools import setup, find_packages setup( name='tomviz-external', version='0.0.1', description='Tomviz python external execution infrastructure.', author='Kitware, Inc.', author_email='[email protected]', url='https://www.tomviz.org/', license='BSD 3-Clause', classifiers=[ ...
Add scipy as dependency for tomviz-pipeline
Add scipy as dependency for tomviz-pipeline
Python
bsd-3-clause
mathturtle/tomviz,mathturtle/tomviz,OpenChemistry/tomviz,OpenChemistry/tomviz,OpenChemistry/tomviz,mathturtle/tomviz,OpenChemistry/tomviz
from setuptools import setup, find_packages setup( name='tomviz-external', version='0.0.1', description='Tomviz python external execution infrastructure.', author='Kitware, Inc.', author_email='[email protected]', url='https://www.tomviz.org/', license='BSD 3-Clause', classifiers=[ ...
from setuptools import setup, find_packages setup( name='tomviz-external', version='0.0.1', description='Tomviz python external execution infrastructure.', author='Kitware, Inc.', author_email='[email protected]', url='https://www.tomviz.org/', license='BSD 3-Clause', classifiers=[ ...
<commit_before>from setuptools import setup, find_packages setup( name='tomviz-external', version='0.0.1', description='Tomviz python external execution infrastructure.', author='Kitware, Inc.', author_email='[email protected]', url='https://www.tomviz.org/', license='BSD 3-Clause', c...
from setuptools import setup, find_packages setup( name='tomviz-external', version='0.0.1', description='Tomviz python external execution infrastructure.', author='Kitware, Inc.', author_email='[email protected]', url='https://www.tomviz.org/', license='BSD 3-Clause', classifiers=[ ...
from setuptools import setup, find_packages setup( name='tomviz-external', version='0.0.1', description='Tomviz python external execution infrastructure.', author='Kitware, Inc.', author_email='[email protected]', url='https://www.tomviz.org/', license='BSD 3-Clause', classifiers=[ ...
<commit_before>from setuptools import setup, find_packages setup( name='tomviz-external', version='0.0.1', description='Tomviz python external execution infrastructure.', author='Kitware, Inc.', author_email='[email protected]', url='https://www.tomviz.org/', license='BSD 3-Clause', c...
fd660a62bd142d4ef36bde44a02b28146498bfc6
driver_code_test.py
driver_code_test.py
import SimpleCV as scv from SimpleCV import Image import cv2 import time from start_camera import start_camera import threading # camera_thread = threading.Thread(target=start_camera) # camera_thread.start() # from get_images_from_pi import get_image, valid_image # time.sleep(2) # count = 0 # while (count < 50): # g...
import SimpleCV as scv from SimpleCV import Image import cv2 import time from start_camera import start_camera import threading def take_50_pictures(): camera_thread = threading.Thread(target=start_camera) camera_thread.start() from get_images_from_pi import get_image, valid_image time.sleep(2) count = 0 w...
Add simple logic to driver code test for easy testing
Add simple logic to driver code test for easy testing
Python
mit
jwarshaw/RaspberryDrive
import SimpleCV as scv from SimpleCV import Image import cv2 import time from start_camera import start_camera import threading # camera_thread = threading.Thread(target=start_camera) # camera_thread.start() # from get_images_from_pi import get_image, valid_image # time.sleep(2) # count = 0 # while (count < 50): # g...
import SimpleCV as scv from SimpleCV import Image import cv2 import time from start_camera import start_camera import threading def take_50_pictures(): camera_thread = threading.Thread(target=start_camera) camera_thread.start() from get_images_from_pi import get_image, valid_image time.sleep(2) count = 0 w...
<commit_before>import SimpleCV as scv from SimpleCV import Image import cv2 import time from start_camera import start_camera import threading # camera_thread = threading.Thread(target=start_camera) # camera_thread.start() # from get_images_from_pi import get_image, valid_image # time.sleep(2) # count = 0 # while (cou...
import SimpleCV as scv from SimpleCV import Image import cv2 import time from start_camera import start_camera import threading def take_50_pictures(): camera_thread = threading.Thread(target=start_camera) camera_thread.start() from get_images_from_pi import get_image, valid_image time.sleep(2) count = 0 w...
import SimpleCV as scv from SimpleCV import Image import cv2 import time from start_camera import start_camera import threading # camera_thread = threading.Thread(target=start_camera) # camera_thread.start() # from get_images_from_pi import get_image, valid_image # time.sleep(2) # count = 0 # while (count < 50): # g...
<commit_before>import SimpleCV as scv from SimpleCV import Image import cv2 import time from start_camera import start_camera import threading # camera_thread = threading.Thread(target=start_camera) # camera_thread.start() # from get_images_from_pi import get_image, valid_image # time.sleep(2) # count = 0 # while (cou...
83dce279fcf157f9ca4cc2e7dbdad55db9f1f857
play.py
play.py
#!/usr/bin/python3 import readline import random import shelve import sys from src import parser from src import locations from src import classes player = classes.Player(locations, locations.start) previousNoun = '' turns = 0 while True: try: command = parser.parseCommand(input('> ')) if command ...
#!/usr/bin/python3 import os import readline import random import shelve import sys os.chdir(os.path.dirname(os.path.abspath(__file__))) from src import parser from src import locations from src import classes player = classes.Player(locations, locations.start) previousNoun = '' turns = 0 while True: try: ...
Fix issue where game could be in wrong cwd
Fix issue where game could be in wrong cwd
Python
mit
disorientedperson/python-adventure-game,allanburleson/python-adventure-game
#!/usr/bin/python3 import readline import random import shelve import sys from src import parser from src import locations from src import classes player = classes.Player(locations, locations.start) previousNoun = '' turns = 0 while True: try: command = parser.parseCommand(input('> ')) if command ...
#!/usr/bin/python3 import os import readline import random import shelve import sys os.chdir(os.path.dirname(os.path.abspath(__file__))) from src import parser from src import locations from src import classes player = classes.Player(locations, locations.start) previousNoun = '' turns = 0 while True: try: ...
<commit_before>#!/usr/bin/python3 import readline import random import shelve import sys from src import parser from src import locations from src import classes player = classes.Player(locations, locations.start) previousNoun = '' turns = 0 while True: try: command = parser.parseCommand(input('> ')) ...
#!/usr/bin/python3 import os import readline import random import shelve import sys os.chdir(os.path.dirname(os.path.abspath(__file__))) from src import parser from src import locations from src import classes player = classes.Player(locations, locations.start) previousNoun = '' turns = 0 while True: try: ...
#!/usr/bin/python3 import readline import random import shelve import sys from src import parser from src import locations from src import classes player = classes.Player(locations, locations.start) previousNoun = '' turns = 0 while True: try: command = parser.parseCommand(input('> ')) if command ...
<commit_before>#!/usr/bin/python3 import readline import random import shelve import sys from src import parser from src import locations from src import classes player = classes.Player(locations, locations.start) previousNoun = '' turns = 0 while True: try: command = parser.parseCommand(input('> ')) ...
5278af1e7de42d4e881a0888074a02cce2831591
utils.py
utils.py
from pylab import * import rebound as re def outer_solar_system(): sim = re.Simulation() sim.add(['Sun', 'Jupiter', 'Saturn', 'Uranus', 'Neptune']) sim.move_to_com() sim.dt = 4 sim.integrator = 'whfast' sim.integrator_whfast_safe_mode = 0 sim.integrator_whfast_corrector = 11 retur...
from pylab import * import rebound as re def outer_solar_system(): sim = re.Simulation() sim.add(['Sun', 'Jupiter', 'Saturn', 'Uranus', 'Neptune']) sim.move_to_com() sim.dt = 4 sim.integrator = 'whfast' sim.integrator_whfast_safe_mode = 0 sim.integrator_whfast_corrector = 11 retur...
Make planar perturber *really* planar.
Make planar perturber *really* planar.
Python
mit
farr/PlanetIX
from pylab import * import rebound as re def outer_solar_system(): sim = re.Simulation() sim.add(['Sun', 'Jupiter', 'Saturn', 'Uranus', 'Neptune']) sim.move_to_com() sim.dt = 4 sim.integrator = 'whfast' sim.integrator_whfast_safe_mode = 0 sim.integrator_whfast_corrector = 11 retur...
from pylab import * import rebound as re def outer_solar_system(): sim = re.Simulation() sim.add(['Sun', 'Jupiter', 'Saturn', 'Uranus', 'Neptune']) sim.move_to_com() sim.dt = 4 sim.integrator = 'whfast' sim.integrator_whfast_safe_mode = 0 sim.integrator_whfast_corrector = 11 retur...
<commit_before>from pylab import * import rebound as re def outer_solar_system(): sim = re.Simulation() sim.add(['Sun', 'Jupiter', 'Saturn', 'Uranus', 'Neptune']) sim.move_to_com() sim.dt = 4 sim.integrator = 'whfast' sim.integrator_whfast_safe_mode = 0 sim.integrator_whfast_corrector = 11...
from pylab import * import rebound as re def outer_solar_system(): sim = re.Simulation() sim.add(['Sun', 'Jupiter', 'Saturn', 'Uranus', 'Neptune']) sim.move_to_com() sim.dt = 4 sim.integrator = 'whfast' sim.integrator_whfast_safe_mode = 0 sim.integrator_whfast_corrector = 11 retur...
from pylab import * import rebound as re def outer_solar_system(): sim = re.Simulation() sim.add(['Sun', 'Jupiter', 'Saturn', 'Uranus', 'Neptune']) sim.move_to_com() sim.dt = 4 sim.integrator = 'whfast' sim.integrator_whfast_safe_mode = 0 sim.integrator_whfast_corrector = 11 retur...
<commit_before>from pylab import * import rebound as re def outer_solar_system(): sim = re.Simulation() sim.add(['Sun', 'Jupiter', 'Saturn', 'Uranus', 'Neptune']) sim.move_to_com() sim.dt = 4 sim.integrator = 'whfast' sim.integrator_whfast_safe_mode = 0 sim.integrator_whfast_corrector = 11...
e5f88d065601972bf1e7abebc69f9235b08d4c62
easyium/__init__.py
easyium/__init__.py
__author__ = 'karl.gong' try: import appium appium_installed = True except ImportError: appium_installed = False
from .webdriver import WebDriver, WebDriverType from .staticelement import StaticElement from .identifier import Identifier from .waits.waiter import wait_for __author__ = 'karl.gong' try: import appium appium_installed = True except ImportError: appium_installed = False
Add package "shortcuts" for classes&function
Add package "shortcuts" for classes&function
Python
apache-2.0
KarlGong/easyium-python,KarlGong/easyium
__author__ = 'karl.gong' try: import appium appium_installed = True except ImportError: appium_installed = FalseAdd package "shortcuts" for classes&function
from .webdriver import WebDriver, WebDriverType from .staticelement import StaticElement from .identifier import Identifier from .waits.waiter import wait_for __author__ = 'karl.gong' try: import appium appium_installed = True except ImportError: appium_installed = False
<commit_before>__author__ = 'karl.gong' try: import appium appium_installed = True except ImportError: appium_installed = False<commit_msg>Add package "shortcuts" for classes&function<commit_after>
from .webdriver import WebDriver, WebDriverType from .staticelement import StaticElement from .identifier import Identifier from .waits.waiter import wait_for __author__ = 'karl.gong' try: import appium appium_installed = True except ImportError: appium_installed = False
__author__ = 'karl.gong' try: import appium appium_installed = True except ImportError: appium_installed = FalseAdd package "shortcuts" for classes&functionfrom .webdriver import WebDriver, WebDriverType from .staticelement import StaticElement from .identifier import Identifier from .waits.waiter import w...
<commit_before>__author__ = 'karl.gong' try: import appium appium_installed = True except ImportError: appium_installed = False<commit_msg>Add package "shortcuts" for classes&function<commit_after>from .webdriver import WebDriver, WebDriverType from .staticelement import StaticElement from .identifier impo...
fc23b7e6a330bd24d49edb60df3a7e8d948c6c32
main.py
main.py
from kivy.app import App from kivy.uix.widget import Widget from kivy.clock import Clock from kivy.graphics import Canvas, Color, Rectangle from action_map import ActionMap from camera import Camera from graphics import Graphics class ActionGame(Widget): action_map = ActionMap() graphics = Graphics() def...
from kivy.app import App from kivy.uix.widget import Widget from kivy.clock import Clock from kivy.graphics import Canvas, Color, Rectangle from action_map import ActionMap from camera import Camera from graphics import Graphics class ActionGame(Widget): action_map = ActionMap() graphics = Graphics() def...
Simplify camera response to touch input
Simplify camera response to touch input
Python
mit
Corrob/Action-Game
from kivy.app import App from kivy.uix.widget import Widget from kivy.clock import Clock from kivy.graphics import Canvas, Color, Rectangle from action_map import ActionMap from camera import Camera from graphics import Graphics class ActionGame(Widget): action_map = ActionMap() graphics = Graphics() def...
from kivy.app import App from kivy.uix.widget import Widget from kivy.clock import Clock from kivy.graphics import Canvas, Color, Rectangle from action_map import ActionMap from camera import Camera from graphics import Graphics class ActionGame(Widget): action_map = ActionMap() graphics = Graphics() def...
<commit_before>from kivy.app import App from kivy.uix.widget import Widget from kivy.clock import Clock from kivy.graphics import Canvas, Color, Rectangle from action_map import ActionMap from camera import Camera from graphics import Graphics class ActionGame(Widget): action_map = ActionMap() graphics = Grap...
from kivy.app import App from kivy.uix.widget import Widget from kivy.clock import Clock from kivy.graphics import Canvas, Color, Rectangle from action_map import ActionMap from camera import Camera from graphics import Graphics class ActionGame(Widget): action_map = ActionMap() graphics = Graphics() def...
from kivy.app import App from kivy.uix.widget import Widget from kivy.clock import Clock from kivy.graphics import Canvas, Color, Rectangle from action_map import ActionMap from camera import Camera from graphics import Graphics class ActionGame(Widget): action_map = ActionMap() graphics = Graphics() def...
<commit_before>from kivy.app import App from kivy.uix.widget import Widget from kivy.clock import Clock from kivy.graphics import Canvas, Color, Rectangle from action_map import ActionMap from camera import Camera from graphics import Graphics class ActionGame(Widget): action_map = ActionMap() graphics = Grap...
c51fd4f744b2b420080500e21d78b4fda17bdccf
main.py
main.py
from flask import Flask from flask import jsonify from slack_helper import SlackHelper import os app = Flask(__name__) slack_helper = SlackHelper() @app.route("/") def hello(): return "Bedlam Slack Slash Commands" @app.route("/slash/random-number", methods=['POST']) def random(): if not slack_helper.vali...
from flask import Flask from flask import jsonify from slack_helper import SlackHelper import os app = Flask(__name__) slack_helper = SlackHelper() @app.route("/") def hello(): return "Bedlam Slack Slash Commands" @app.route("/slash/random-number", methods=['POST']) def random(): if not slack_helper.vali...
Update to cat gif code
Update to cat gif code
Python
mit
martinpeck/bedlam-slack,martinpeck/bedlam-slack
from flask import Flask from flask import jsonify from slack_helper import SlackHelper import os app = Flask(__name__) slack_helper = SlackHelper() @app.route("/") def hello(): return "Bedlam Slack Slash Commands" @app.route("/slash/random-number", methods=['POST']) def random(): if not slack_helper.vali...
from flask import Flask from flask import jsonify from slack_helper import SlackHelper import os app = Flask(__name__) slack_helper = SlackHelper() @app.route("/") def hello(): return "Bedlam Slack Slash Commands" @app.route("/slash/random-number", methods=['POST']) def random(): if not slack_helper.vali...
<commit_before>from flask import Flask from flask import jsonify from slack_helper import SlackHelper import os app = Flask(__name__) slack_helper = SlackHelper() @app.route("/") def hello(): return "Bedlam Slack Slash Commands" @app.route("/slash/random-number", methods=['POST']) def random(): if not sl...
from flask import Flask from flask import jsonify from slack_helper import SlackHelper import os app = Flask(__name__) slack_helper = SlackHelper() @app.route("/") def hello(): return "Bedlam Slack Slash Commands" @app.route("/slash/random-number", methods=['POST']) def random(): if not slack_helper.vali...
from flask import Flask from flask import jsonify from slack_helper import SlackHelper import os app = Flask(__name__) slack_helper = SlackHelper() @app.route("/") def hello(): return "Bedlam Slack Slash Commands" @app.route("/slash/random-number", methods=['POST']) def random(): if not slack_helper.vali...
<commit_before>from flask import Flask from flask import jsonify from slack_helper import SlackHelper import os app = Flask(__name__) slack_helper = SlackHelper() @app.route("/") def hello(): return "Bedlam Slack Slash Commands" @app.route("/slash/random-number", methods=['POST']) def random(): if not sl...
6f8692d0345652acc5e4c858e0e2a3f688dc574f
project/views/twilioviews.py
project/views/twilioviews.py
from flask import request import requests from ..utils.status import get_status from ..utils.reminders import create_reminder import twilio.twiml import json import dateutil def call(): resp = twilio.twiml.Response() resp.record(timeout=10, transcribe=True, transcribeCallback='http://queri.me/rec',...
from flask import request import requests from ..utils.status import get_status from ..utils.reminders import create_reminder import twilio.twiml import json import dateutil def call(): resp = twilio.twiml.Response() resp.record(timeout=10, transcribe=True, transcribeCallback='http://queri.me/rec',...
Select the message text in twilio
Select the message text in twilio
Python
apache-2.0
tjcsl/mhacksiv
from flask import request import requests from ..utils.status import get_status from ..utils.reminders import create_reminder import twilio.twiml import json import dateutil def call(): resp = twilio.twiml.Response() resp.record(timeout=10, transcribe=True, transcribeCallback='http://queri.me/rec',...
from flask import request import requests from ..utils.status import get_status from ..utils.reminders import create_reminder import twilio.twiml import json import dateutil def call(): resp = twilio.twiml.Response() resp.record(timeout=10, transcribe=True, transcribeCallback='http://queri.me/rec',...
<commit_before>from flask import request import requests from ..utils.status import get_status from ..utils.reminders import create_reminder import twilio.twiml import json import dateutil def call(): resp = twilio.twiml.Response() resp.record(timeout=10, transcribe=True, transcribeCallback='http:/...
from flask import request import requests from ..utils.status import get_status from ..utils.reminders import create_reminder import twilio.twiml import json import dateutil def call(): resp = twilio.twiml.Response() resp.record(timeout=10, transcribe=True, transcribeCallback='http://queri.me/rec',...
from flask import request import requests from ..utils.status import get_status from ..utils.reminders import create_reminder import twilio.twiml import json import dateutil def call(): resp = twilio.twiml.Response() resp.record(timeout=10, transcribe=True, transcribeCallback='http://queri.me/rec',...
<commit_before>from flask import request import requests from ..utils.status import get_status from ..utils.reminders import create_reminder import twilio.twiml import json import dateutil def call(): resp = twilio.twiml.Response() resp.record(timeout=10, transcribe=True, transcribeCallback='http:/...
c5aedc4264cb8327a6fb86598d615bdf287102fb
osrframework/__init__.py
osrframework/__init__.py
# -*- coding: cp1252 -*- # ################################################################################## # # Copyright 2014-2017 Félix Brezo and Yaiza Rubio (i3visio, [email protected]) # # OSRFramework is free software: you can redistribute it and/or modify # it under the terms of the GNU General Public Lic...
# -*- coding: cp1252 -*- # ################################################################################## # # Copyright 2014-2017 Félix Brezo and Yaiza Rubio (i3visio, [email protected]) # # OSRFramework is free software: you can redistribute it and/or modify # it under the terms of the GNU General Public Lic...
Set release version to 0.15.0rc5
Set release version to 0.15.0rc5
Python
agpl-3.0
i3visio/osrframework
# -*- coding: cp1252 -*- # ################################################################################## # # Copyright 2014-2017 Félix Brezo and Yaiza Rubio (i3visio, [email protected]) # # OSRFramework is free software: you can redistribute it and/or modify # it under the terms of the GNU General Public Lic...
# -*- coding: cp1252 -*- # ################################################################################## # # Copyright 2014-2017 Félix Brezo and Yaiza Rubio (i3visio, [email protected]) # # OSRFramework is free software: you can redistribute it and/or modify # it under the terms of the GNU General Public Lic...
<commit_before># -*- coding: cp1252 -*- # ################################################################################## # # Copyright 2014-2017 Félix Brezo and Yaiza Rubio (i3visio, [email protected]) # # OSRFramework is free software: you can redistribute it and/or modify # it under the terms of the GNU Gen...
# -*- coding: cp1252 -*- # ################################################################################## # # Copyright 2014-2017 Félix Brezo and Yaiza Rubio (i3visio, [email protected]) # # OSRFramework is free software: you can redistribute it and/or modify # it under the terms of the GNU General Public Lic...
# -*- coding: cp1252 -*- # ################################################################################## # # Copyright 2014-2017 Félix Brezo and Yaiza Rubio (i3visio, [email protected]) # # OSRFramework is free software: you can redistribute it and/or modify # it under the terms of the GNU General Public Lic...
<commit_before># -*- coding: cp1252 -*- # ################################################################################## # # Copyright 2014-2017 Félix Brezo and Yaiza Rubio (i3visio, [email protected]) # # OSRFramework is free software: you can redistribute it and/or modify # it under the terms of the GNU Gen...
506b3399fe20b0267e26a944b49d9ab16d927b31
test.py
test.py
import parser, codegen, compile import sys, os, unittest, subprocess DIR = os.path.dirname(__file__) TESTS_DIR = os.path.join(DIR, 'tests') TESTS = [ 'hello', 'print-int', 'multi-stmt', 'int-add', 'var-hello', ] def run(self, key): fullname = os.path.join(TESTS_DIR, key + '.lng') base = fullname.rsplit('.lng', ...
import parser, codegen, compile import sys, os, unittest, subprocess DIR = os.path.dirname(__file__) TESTS_DIR = os.path.join(DIR, 'tests') TESTS = [ 'hello', 'print-int', 'multi-stmt', 'int-add', 'var-hello', 'int-var', ] def run(self, key): fullname = os.path.join(TESTS_DIR, key + '.lng') base = fullname.rspl...
Verify that integer variables also work.
Verify that integer variables also work.
Python
mit
djc/runa,djc/runa,djc/runa,djc/runa
import parser, codegen, compile import sys, os, unittest, subprocess DIR = os.path.dirname(__file__) TESTS_DIR = os.path.join(DIR, 'tests') TESTS = [ 'hello', 'print-int', 'multi-stmt', 'int-add', 'var-hello', ] def run(self, key): fullname = os.path.join(TESTS_DIR, key + '.lng') base = fullname.rsplit('.lng', ...
import parser, codegen, compile import sys, os, unittest, subprocess DIR = os.path.dirname(__file__) TESTS_DIR = os.path.join(DIR, 'tests') TESTS = [ 'hello', 'print-int', 'multi-stmt', 'int-add', 'var-hello', 'int-var', ] def run(self, key): fullname = os.path.join(TESTS_DIR, key + '.lng') base = fullname.rspl...
<commit_before>import parser, codegen, compile import sys, os, unittest, subprocess DIR = os.path.dirname(__file__) TESTS_DIR = os.path.join(DIR, 'tests') TESTS = [ 'hello', 'print-int', 'multi-stmt', 'int-add', 'var-hello', ] def run(self, key): fullname = os.path.join(TESTS_DIR, key + '.lng') base = fullname....
import parser, codegen, compile import sys, os, unittest, subprocess DIR = os.path.dirname(__file__) TESTS_DIR = os.path.join(DIR, 'tests') TESTS = [ 'hello', 'print-int', 'multi-stmt', 'int-add', 'var-hello', 'int-var', ] def run(self, key): fullname = os.path.join(TESTS_DIR, key + '.lng') base = fullname.rspl...
import parser, codegen, compile import sys, os, unittest, subprocess DIR = os.path.dirname(__file__) TESTS_DIR = os.path.join(DIR, 'tests') TESTS = [ 'hello', 'print-int', 'multi-stmt', 'int-add', 'var-hello', ] def run(self, key): fullname = os.path.join(TESTS_DIR, key + '.lng') base = fullname.rsplit('.lng', ...
<commit_before>import parser, codegen, compile import sys, os, unittest, subprocess DIR = os.path.dirname(__file__) TESTS_DIR = os.path.join(DIR, 'tests') TESTS = [ 'hello', 'print-int', 'multi-stmt', 'int-add', 'var-hello', ] def run(self, key): fullname = os.path.join(TESTS_DIR, key + '.lng') base = fullname....
a8ed783aff7a725260904d84e36e1f4ac7ed91b3
example_slack.py
example_slack.py
#!/usr/bin/env python """Sets a luxafor flag based on status.""" import luxafor import os import time from slackclient import SlackClient slack_token = os.environ["SLACK_API_TOKEN"] sc = SlackClient(slack_token) API = luxafor.API() while (True): presence = sc.api_call("dnd.info") if presence['snooze_enabl...
#!/usr/bin/env python """Sets a luxafor flag based on status.""" import luxafor import os import time from slackclient import SlackClient slack_token = os.environ["SLACK_API_TOKEN"] slack_client = SlackClient(slack_token) lux = luxafor.API() snooze_remaining = -1 # Countdown timer user_id = 'U024G0M2L' if slack_cl...
Switch to use RTM protocol
Switch to use RTM protocol There isn’t an RTM event for ‘stops being DND’ so I’ve added a simple countdown loop, it loses about a second or two, but it works. Happy to have feedback on the loops / logic, feels like it could be sharper.
Python
mit
blancltd/luxafor
#!/usr/bin/env python """Sets a luxafor flag based on status.""" import luxafor import os import time from slackclient import SlackClient slack_token = os.environ["SLACK_API_TOKEN"] sc = SlackClient(slack_token) API = luxafor.API() while (True): presence = sc.api_call("dnd.info") if presence['snooze_enabl...
#!/usr/bin/env python """Sets a luxafor flag based on status.""" import luxafor import os import time from slackclient import SlackClient slack_token = os.environ["SLACK_API_TOKEN"] slack_client = SlackClient(slack_token) lux = luxafor.API() snooze_remaining = -1 # Countdown timer user_id = 'U024G0M2L' if slack_cl...
<commit_before>#!/usr/bin/env python """Sets a luxafor flag based on status.""" import luxafor import os import time from slackclient import SlackClient slack_token = os.environ["SLACK_API_TOKEN"] sc = SlackClient(slack_token) API = luxafor.API() while (True): presence = sc.api_call("dnd.info") if presenc...
#!/usr/bin/env python """Sets a luxafor flag based on status.""" import luxafor import os import time from slackclient import SlackClient slack_token = os.environ["SLACK_API_TOKEN"] slack_client = SlackClient(slack_token) lux = luxafor.API() snooze_remaining = -1 # Countdown timer user_id = 'U024G0M2L' if slack_cl...
#!/usr/bin/env python """Sets a luxafor flag based on status.""" import luxafor import os import time from slackclient import SlackClient slack_token = os.environ["SLACK_API_TOKEN"] sc = SlackClient(slack_token) API = luxafor.API() while (True): presence = sc.api_call("dnd.info") if presence['snooze_enabl...
<commit_before>#!/usr/bin/env python """Sets a luxafor flag based on status.""" import luxafor import os import time from slackclient import SlackClient slack_token = os.environ["SLACK_API_TOKEN"] sc = SlackClient(slack_token) API = luxafor.API() while (True): presence = sc.api_call("dnd.info") if presenc...
a452adfb297ff40ec3db71108681829769b1fba4
pyface/tasks/enaml_editor.py
pyface/tasks/enaml_editor.py
# Enthought library imports. from traits.api import Instance, on_trait_change from enaml.components.constraints_widget import ConstraintsWidget # local imports from pyface.tasks.editor import Editor class EnamlEditor(Editor): """ Create an Editor for Enaml Components. """ #### EnamlEditor interface ####...
# Enthought library imports. from traits.api import Instance, on_trait_change from enaml.components.constraints_widget import ConstraintsWidget # local imports from pyface.tasks.editor import Editor class EnamlEditor(Editor): """ Create an Editor for Enaml Components. """ #### EnamlEditor interface ####...
Remove call of unimplemented method.
BUG: Remove call of unimplemented method.
Python
bsd-3-clause
brett-patterson/pyface,pankajp/pyface,geggo/pyface,geggo/pyface
# Enthought library imports. from traits.api import Instance, on_trait_change from enaml.components.constraints_widget import ConstraintsWidget # local imports from pyface.tasks.editor import Editor class EnamlEditor(Editor): """ Create an Editor for Enaml Components. """ #### EnamlEditor interface ####...
# Enthought library imports. from traits.api import Instance, on_trait_change from enaml.components.constraints_widget import ConstraintsWidget # local imports from pyface.tasks.editor import Editor class EnamlEditor(Editor): """ Create an Editor for Enaml Components. """ #### EnamlEditor interface ####...
<commit_before># Enthought library imports. from traits.api import Instance, on_trait_change from enaml.components.constraints_widget import ConstraintsWidget # local imports from pyface.tasks.editor import Editor class EnamlEditor(Editor): """ Create an Editor for Enaml Components. """ #### EnamlEditor...
# Enthought library imports. from traits.api import Instance, on_trait_change from enaml.components.constraints_widget import ConstraintsWidget # local imports from pyface.tasks.editor import Editor class EnamlEditor(Editor): """ Create an Editor for Enaml Components. """ #### EnamlEditor interface ####...
# Enthought library imports. from traits.api import Instance, on_trait_change from enaml.components.constraints_widget import ConstraintsWidget # local imports from pyface.tasks.editor import Editor class EnamlEditor(Editor): """ Create an Editor for Enaml Components. """ #### EnamlEditor interface ####...
<commit_before># Enthought library imports. from traits.api import Instance, on_trait_change from enaml.components.constraints_widget import ConstraintsWidget # local imports from pyface.tasks.editor import Editor class EnamlEditor(Editor): """ Create an Editor for Enaml Components. """ #### EnamlEditor...
938fc30d5a0067bb80525c8db450e064c29597e5
tx_salaries/managers.py
tx_salaries/managers.py
from django.db import models class DenormalizeManagerMixin(object): def update_cohort(self, cohort, **kwargs): stats, created = self.get_or_create(**kwargs) stats.highest_paid = cohort.order_by('-compensation')[0] stats.lowest_paid = cohort.order_by('compensation')[0] stats.save() ...
from django.db import models class DenormalizeManagerMixin(object): def update_cohort(self, cohort, **kwargs): stats, created = self.get_or_create(**kwargs) stats.highest_paid = cohort.order_by('-compensation')[0] stats.lowest_paid = cohort.order_by('compensation')[0] stats.save() ...
Fix this code so it works
Fix this code so it works
Python
apache-2.0
texastribune/tx_salaries,texastribune/tx_salaries
from django.db import models class DenormalizeManagerMixin(object): def update_cohort(self, cohort, **kwargs): stats, created = self.get_or_create(**kwargs) stats.highest_paid = cohort.order_by('-compensation')[0] stats.lowest_paid = cohort.order_by('compensation')[0] stats.save() ...
from django.db import models class DenormalizeManagerMixin(object): def update_cohort(self, cohort, **kwargs): stats, created = self.get_or_create(**kwargs) stats.highest_paid = cohort.order_by('-compensation')[0] stats.lowest_paid = cohort.order_by('compensation')[0] stats.save() ...
<commit_before>from django.db import models class DenormalizeManagerMixin(object): def update_cohort(self, cohort, **kwargs): stats, created = self.get_or_create(**kwargs) stats.highest_paid = cohort.order_by('-compensation')[0] stats.lowest_paid = cohort.order_by('compensation')[0] ...
from django.db import models class DenormalizeManagerMixin(object): def update_cohort(self, cohort, **kwargs): stats, created = self.get_or_create(**kwargs) stats.highest_paid = cohort.order_by('-compensation')[0] stats.lowest_paid = cohort.order_by('compensation')[0] stats.save() ...
from django.db import models class DenormalizeManagerMixin(object): def update_cohort(self, cohort, **kwargs): stats, created = self.get_or_create(**kwargs) stats.highest_paid = cohort.order_by('-compensation')[0] stats.lowest_paid = cohort.order_by('compensation')[0] stats.save() ...
<commit_before>from django.db import models class DenormalizeManagerMixin(object): def update_cohort(self, cohort, **kwargs): stats, created = self.get_or_create(**kwargs) stats.highest_paid = cohort.order_by('-compensation')[0] stats.lowest_paid = cohort.order_by('compensation')[0] ...
f9cb73670966d7cb3ade12056c92c479404cbb07
pythran/tests/test_cython.py
pythran/tests/test_cython.py
import os import unittest class TestCython(unittest.TestCase): pass def add_test(name, runner, target): setattr(TestCython, "test_" + name, lambda s: runner(s, target)) try: import Cython import glob import sys targets = glob.glob(os.path.join(os.path.dirname(__file__), "cython", "setup_*.py"...
import os import unittest class TestCython(unittest.TestCase): pass # Needs to wait unil cython supports pythran new builtins naming #def add_test(name, runner, target): # setattr(TestCython, "test_" + name, lambda s: runner(s, target)) # #try: # import Cython # import glob # import sys # targets = ...
Disable Cython test until Cython support new pythonic layout
Disable Cython test until Cython support new pythonic layout
Python
bsd-3-clause
serge-sans-paille/pythran,serge-sans-paille/pythran,pombredanne/pythran,pombredanne/pythran,pombredanne/pythran
import os import unittest class TestCython(unittest.TestCase): pass def add_test(name, runner, target): setattr(TestCython, "test_" + name, lambda s: runner(s, target)) try: import Cython import glob import sys targets = glob.glob(os.path.join(os.path.dirname(__file__), "cython", "setup_*.py"...
import os import unittest class TestCython(unittest.TestCase): pass # Needs to wait unil cython supports pythran new builtins naming #def add_test(name, runner, target): # setattr(TestCython, "test_" + name, lambda s: runner(s, target)) # #try: # import Cython # import glob # import sys # targets = ...
<commit_before>import os import unittest class TestCython(unittest.TestCase): pass def add_test(name, runner, target): setattr(TestCython, "test_" + name, lambda s: runner(s, target)) try: import Cython import glob import sys targets = glob.glob(os.path.join(os.path.dirname(__file__), "cython...
import os import unittest class TestCython(unittest.TestCase): pass # Needs to wait unil cython supports pythran new builtins naming #def add_test(name, runner, target): # setattr(TestCython, "test_" + name, lambda s: runner(s, target)) # #try: # import Cython # import glob # import sys # targets = ...
import os import unittest class TestCython(unittest.TestCase): pass def add_test(name, runner, target): setattr(TestCython, "test_" + name, lambda s: runner(s, target)) try: import Cython import glob import sys targets = glob.glob(os.path.join(os.path.dirname(__file__), "cython", "setup_*.py"...
<commit_before>import os import unittest class TestCython(unittest.TestCase): pass def add_test(name, runner, target): setattr(TestCython, "test_" + name, lambda s: runner(s, target)) try: import Cython import glob import sys targets = glob.glob(os.path.join(os.path.dirname(__file__), "cython...
fb1581dd11cfc74a5c3888430d1f288974e40c76
giphy.py
giphy.py
# -*- coding: utf-8 -*- # # Insert a random giphy URL based on a search # # Usage: /giphy search # # History: # # Version 1.0.1: Auto post gif URL along with query string # Version 1.0.0: initial release # import requests import weechat URL = "http://api.giphy.com/v1/gifs/random?api_key=dc6zaTOxFJmzC&tag=%s" def gi...
# -*- coding: utf-8 -*- # # Insert a random giphy URL based on a search # # Usage: /giphy search # # History: # # Version 1.0.2: Write text if no matches are found # Version 1.0.1: Auto post gif URL along with query string # Version 1.0.0: initial release # import requests import weechat URL = "http://api.giphy.com/v...
Write error if no matching gifs are found
Write error if no matching gifs are found
Python
mit
keith/giphy-weechat
# -*- coding: utf-8 -*- # # Insert a random giphy URL based on a search # # Usage: /giphy search # # History: # # Version 1.0.1: Auto post gif URL along with query string # Version 1.0.0: initial release # import requests import weechat URL = "http://api.giphy.com/v1/gifs/random?api_key=dc6zaTOxFJmzC&tag=%s" def gi...
# -*- coding: utf-8 -*- # # Insert a random giphy URL based on a search # # Usage: /giphy search # # History: # # Version 1.0.2: Write text if no matches are found # Version 1.0.1: Auto post gif URL along with query string # Version 1.0.0: initial release # import requests import weechat URL = "http://api.giphy.com/v...
<commit_before># -*- coding: utf-8 -*- # # Insert a random giphy URL based on a search # # Usage: /giphy search # # History: # # Version 1.0.1: Auto post gif URL along with query string # Version 1.0.0: initial release # import requests import weechat URL = "http://api.giphy.com/v1/gifs/random?api_key=dc6zaTOxFJmzC&t...
# -*- coding: utf-8 -*- # # Insert a random giphy URL based on a search # # Usage: /giphy search # # History: # # Version 1.0.2: Write text if no matches are found # Version 1.0.1: Auto post gif URL along with query string # Version 1.0.0: initial release # import requests import weechat URL = "http://api.giphy.com/v...
# -*- coding: utf-8 -*- # # Insert a random giphy URL based on a search # # Usage: /giphy search # # History: # # Version 1.0.1: Auto post gif URL along with query string # Version 1.0.0: initial release # import requests import weechat URL = "http://api.giphy.com/v1/gifs/random?api_key=dc6zaTOxFJmzC&tag=%s" def gi...
<commit_before># -*- coding: utf-8 -*- # # Insert a random giphy URL based on a search # # Usage: /giphy search # # History: # # Version 1.0.1: Auto post gif URL along with query string # Version 1.0.0: initial release # import requests import weechat URL = "http://api.giphy.com/v1/gifs/random?api_key=dc6zaTOxFJmzC&t...
1eb411a45f74819a039dfc1330decb212e1961a6
rollbar/test/async_helper.py
rollbar/test/async_helper.py
import asyncio import inspect import sys import rollbar def run(coro): if sys.version_info >= (3, 7): return asyncio.run(coro) assert inspect.iscoroutine(coro) loop = asyncio.new_event_loop() asyncio.set_event_loop(loop) try: return loop.run_until_complete(coro) finally: ...
import asyncio import inspect import sys import rollbar def run(coro): if sys.version_info >= (3, 7): return asyncio.run(coro) assert inspect.iscoroutine(coro) loop = asyncio.new_event_loop() asyncio.set_event_loop(loop) try: return loop.run_until_complete(coro) finally: ...
Add BareMiddleware to test helpers
Add BareMiddleware to test helpers
Python
mit
rollbar/pyrollbar
import asyncio import inspect import sys import rollbar def run(coro): if sys.version_info >= (3, 7): return asyncio.run(coro) assert inspect.iscoroutine(coro) loop = asyncio.new_event_loop() asyncio.set_event_loop(loop) try: return loop.run_until_complete(coro) finally: ...
import asyncio import inspect import sys import rollbar def run(coro): if sys.version_info >= (3, 7): return asyncio.run(coro) assert inspect.iscoroutine(coro) loop = asyncio.new_event_loop() asyncio.set_event_loop(loop) try: return loop.run_until_complete(coro) finally: ...
<commit_before>import asyncio import inspect import sys import rollbar def run(coro): if sys.version_info >= (3, 7): return asyncio.run(coro) assert inspect.iscoroutine(coro) loop = asyncio.new_event_loop() asyncio.set_event_loop(loop) try: return loop.run_until_complete(coro) ...
import asyncio import inspect import sys import rollbar def run(coro): if sys.version_info >= (3, 7): return asyncio.run(coro) assert inspect.iscoroutine(coro) loop = asyncio.new_event_loop() asyncio.set_event_loop(loop) try: return loop.run_until_complete(coro) finally: ...
import asyncio import inspect import sys import rollbar def run(coro): if sys.version_info >= (3, 7): return asyncio.run(coro) assert inspect.iscoroutine(coro) loop = asyncio.new_event_loop() asyncio.set_event_loop(loop) try: return loop.run_until_complete(coro) finally: ...
<commit_before>import asyncio import inspect import sys import rollbar def run(coro): if sys.version_info >= (3, 7): return asyncio.run(coro) assert inspect.iscoroutine(coro) loop = asyncio.new_event_loop() asyncio.set_event_loop(loop) try: return loop.run_until_complete(coro) ...
a1be44dcc93a336232807f3ef79a03e73ca31f65
froniusLogger.py
froniusLogger.py
""" Logs key data from a Fronius inverter to a CSV file for later analysis. [email protected] """ import requests import json import datetime import time # Set this to the IP address of your inverter host = "192.168.0.112" sample_seconds = 60 # how many seconds between samples, set to zero to run once and exit ...
""" Logs key data from a Fronius inverter to a CSV file for later analysis. [email protected] """ import requests import json import datetime import time # Set this to the IP address of your inverter host = "192.168.0.112" # number of seconds between samples, set to zero to run once and exit sample_seconds = 60 *...
Set sample times to every 5 minutes. Show the time of a timeout.
Set sample times to every 5 minutes. Show the time of a timeout.
Python
apache-2.0
peterbmarks/froniusLogger,peterbmarks/froniusLogger
""" Logs key data from a Fronius inverter to a CSV file for later analysis. [email protected] """ import requests import json import datetime import time # Set this to the IP address of your inverter host = "192.168.0.112" sample_seconds = 60 # how many seconds between samples, set to zero to run once and exit ...
""" Logs key data from a Fronius inverter to a CSV file for later analysis. [email protected] """ import requests import json import datetime import time # Set this to the IP address of your inverter host = "192.168.0.112" # number of seconds between samples, set to zero to run once and exit sample_seconds = 60 *...
<commit_before>""" Logs key data from a Fronius inverter to a CSV file for later analysis. [email protected] """ import requests import json import datetime import time # Set this to the IP address of your inverter host = "192.168.0.112" sample_seconds = 60 # how many seconds between samples, set to zero to run ...
""" Logs key data from a Fronius inverter to a CSV file for later analysis. [email protected] """ import requests import json import datetime import time # Set this to the IP address of your inverter host = "192.168.0.112" # number of seconds between samples, set to zero to run once and exit sample_seconds = 60 *...
""" Logs key data from a Fronius inverter to a CSV file for later analysis. [email protected] """ import requests import json import datetime import time # Set this to the IP address of your inverter host = "192.168.0.112" sample_seconds = 60 # how many seconds between samples, set to zero to run once and exit ...
<commit_before>""" Logs key data from a Fronius inverter to a CSV file for later analysis. [email protected] """ import requests import json import datetime import time # Set this to the IP address of your inverter host = "192.168.0.112" sample_seconds = 60 # how many seconds between samples, set to zero to run ...
6aa3ed3634a22b89f7128883d20f28f65ed00152
basic.py
basic.py
import os # needed for opening/compiling file import time # needed for delay def getPath(allowCancel = True): """Ask the user for lilypond file path and return it as string. Takes one boolean argument as to whether message should say cancelling is allowed or not. Defaults to true, however this may not be suitabl...
import os; # needed for opening/compiling file import time; # needed for delay def getPath(allowCancel = True): """Ask the user for lilypond file path and return it as string. Takes one boolean argument as to whether message should say cancelling is allowed or not. Defaults to true, however this may not be suita...
Add semicolons to end of program statements
Add semicolons to end of program statements
Python
unlicense
RainCity471/lyCompiler
import os # needed for opening/compiling file import time # needed for delay def getPath(allowCancel = True): """Ask the user for lilypond file path and return it as string. Takes one boolean argument as to whether message should say cancelling is allowed or not. Defaults to true, however this may not be suitabl...
import os; # needed for opening/compiling file import time; # needed for delay def getPath(allowCancel = True): """Ask the user for lilypond file path and return it as string. Takes one boolean argument as to whether message should say cancelling is allowed or not. Defaults to true, however this may not be suita...
<commit_before>import os # needed for opening/compiling file import time # needed for delay def getPath(allowCancel = True): """Ask the user for lilypond file path and return it as string. Takes one boolean argument as to whether message should say cancelling is allowed or not. Defaults to true, however this may...
import os; # needed for opening/compiling file import time; # needed for delay def getPath(allowCancel = True): """Ask the user for lilypond file path and return it as string. Takes one boolean argument as to whether message should say cancelling is allowed or not. Defaults to true, however this may not be suita...
import os # needed for opening/compiling file import time # needed for delay def getPath(allowCancel = True): """Ask the user for lilypond file path and return it as string. Takes one boolean argument as to whether message should say cancelling is allowed or not. Defaults to true, however this may not be suitabl...
<commit_before>import os # needed for opening/compiling file import time # needed for delay def getPath(allowCancel = True): """Ask the user for lilypond file path and return it as string. Takes one boolean argument as to whether message should say cancelling is allowed or not. Defaults to true, however this may...
47afbcf83280fdd4cf80119443524240ea8148ad
lms/djangoapps/grades/migrations/0005_multiple_course_flags.py
lms/djangoapps/grades/migrations/0005_multiple_course_flags.py
# -*- coding: utf-8 -*- from __future__ import unicode_literals from django.db import migrations, models from openedx.core.djangoapps.xmodule_django.models import CourseKeyField class Migration(migrations.Migration): dependencies = [ ('grades', '0004_visibleblocks_course_id'), ] operations = [ ...
# -*- coding: utf-8 -*- from __future__ import unicode_literals from django.db import migrations, models from openedx.core.djangoapps.xmodule_django.models import CourseKeyField class Migration(migrations.Migration): dependencies = [ ('grades', '0004_visibleblocks_course_id'), ] operations = [ ...
Allow grades app to be zero-migrated
Allow grades app to be zero-migrated
Python
agpl-3.0
jolyonb/edx-platform,ESOedX/edx-platform,ESOedX/edx-platform,synergeticsedx/deployment-wipro,angelapper/edx-platform,TeachAtTUM/edx-platform,Stanford-Online/edx-platform,jzoldak/edx-platform,proversity-org/edx-platform,philanthropy-u/edx-platform,mitocw/edx-platform,ahmedaljazzar/edx-platform,jzoldak/edx-platform,Stanf...
# -*- coding: utf-8 -*- from __future__ import unicode_literals from django.db import migrations, models from openedx.core.djangoapps.xmodule_django.models import CourseKeyField class Migration(migrations.Migration): dependencies = [ ('grades', '0004_visibleblocks_course_id'), ] operations = [ ...
# -*- coding: utf-8 -*- from __future__ import unicode_literals from django.db import migrations, models from openedx.core.djangoapps.xmodule_django.models import CourseKeyField class Migration(migrations.Migration): dependencies = [ ('grades', '0004_visibleblocks_course_id'), ] operations = [ ...
<commit_before># -*- coding: utf-8 -*- from __future__ import unicode_literals from django.db import migrations, models from openedx.core.djangoapps.xmodule_django.models import CourseKeyField class Migration(migrations.Migration): dependencies = [ ('grades', '0004_visibleblocks_course_id'), ] ...
# -*- coding: utf-8 -*- from __future__ import unicode_literals from django.db import migrations, models from openedx.core.djangoapps.xmodule_django.models import CourseKeyField class Migration(migrations.Migration): dependencies = [ ('grades', '0004_visibleblocks_course_id'), ] operations = [ ...
# -*- coding: utf-8 -*- from __future__ import unicode_literals from django.db import migrations, models from openedx.core.djangoapps.xmodule_django.models import CourseKeyField class Migration(migrations.Migration): dependencies = [ ('grades', '0004_visibleblocks_course_id'), ] operations = [ ...
<commit_before># -*- coding: utf-8 -*- from __future__ import unicode_literals from django.db import migrations, models from openedx.core.djangoapps.xmodule_django.models import CourseKeyField class Migration(migrations.Migration): dependencies = [ ('grades', '0004_visibleblocks_course_id'), ] ...
c7e5306ede3415838c3cf0861c3a1be8caed38ba
mltsp/run_script_in_container.py
mltsp/run_script_in_container.py
#!/usr/bin/python # run_script_in_container.py # Will be run inside Docker container if __name__ == "__main__": # Run Cython setup script: # from subprocess import call # from mltsp import cfg # call(["%s/make" % cfg.PROJECT_PATH]) import argparse parser = argparse.ArgumentParser(description='...
#!/usr/bin/python # run_script_in_container.py # Will be run inside Docker container if __name__ == "__main__": # Run Cython setup script: # from subprocess import call # from mltsp import cfg # call(["%s/make" % cfg.PROJECT_PATH]) import argparse parser = argparse.ArgumentParser(description='...
Add comment explaining path append
Add comment explaining path append
Python
bsd-3-clause
acrellin/mltsp,acrellin/mltsp,mltsp/mltsp,mltsp/mltsp,acrellin/mltsp,acrellin/mltsp,bnaul/mltsp,bnaul/mltsp,mltsp/mltsp,mltsp/mltsp,acrellin/mltsp,acrellin/mltsp,mltsp/mltsp,bnaul/mltsp,bnaul/mltsp,mltsp/mltsp,bnaul/mltsp,bnaul/mltsp
#!/usr/bin/python # run_script_in_container.py # Will be run inside Docker container if __name__ == "__main__": # Run Cython setup script: # from subprocess import call # from mltsp import cfg # call(["%s/make" % cfg.PROJECT_PATH]) import argparse parser = argparse.ArgumentParser(description='...
#!/usr/bin/python # run_script_in_container.py # Will be run inside Docker container if __name__ == "__main__": # Run Cython setup script: # from subprocess import call # from mltsp import cfg # call(["%s/make" % cfg.PROJECT_PATH]) import argparse parser = argparse.ArgumentParser(description='...
<commit_before>#!/usr/bin/python # run_script_in_container.py # Will be run inside Docker container if __name__ == "__main__": # Run Cython setup script: # from subprocess import call # from mltsp import cfg # call(["%s/make" % cfg.PROJECT_PATH]) import argparse parser = argparse.ArgumentParse...
#!/usr/bin/python # run_script_in_container.py # Will be run inside Docker container if __name__ == "__main__": # Run Cython setup script: # from subprocess import call # from mltsp import cfg # call(["%s/make" % cfg.PROJECT_PATH]) import argparse parser = argparse.ArgumentParser(description='...
#!/usr/bin/python # run_script_in_container.py # Will be run inside Docker container if __name__ == "__main__": # Run Cython setup script: # from subprocess import call # from mltsp import cfg # call(["%s/make" % cfg.PROJECT_PATH]) import argparse parser = argparse.ArgumentParser(description='...
<commit_before>#!/usr/bin/python # run_script_in_container.py # Will be run inside Docker container if __name__ == "__main__": # Run Cython setup script: # from subprocess import call # from mltsp import cfg # call(["%s/make" % cfg.PROJECT_PATH]) import argparse parser = argparse.ArgumentParse...
497d6169340d96b486e0312288da74646bcc6b1f
website/search/util.py
website/search/util.py
def build_query(q='*', start='0', size='10'): return { 'query': build_query_string(q), 'from': start, 'size': size, } def build_query_string(q): return { 'query_string': { 'default_field': '_all', 'query': q, 'analyze_wildcard': True, ...
def build_query(q='*', start=0, size=10): return { 'query': build_query_string(q), 'from': start, 'size': size, } def build_query_string(q): return { 'query_string': { 'default_field': '_all', 'query': q, 'analyze_wildcard': True, ...
Use index use ints not strings
Use index use ints not strings
Python
apache-2.0
Johnetordoff/osf.io,lyndsysimon/osf.io,asanfilippo7/osf.io,zamattiac/osf.io,samchrisinger/osf.io,crcresearch/osf.io,laurenrevere/osf.io,SSJohns/osf.io,felliott/osf.io,kwierman/osf.io,kushG/osf.io,fabianvf/osf.io,DanielSBrown/osf.io,alexschiller/osf.io,GageGaskins/osf.io,brandonPurvis/osf.io,zamattiac/osf.io,cwisecarver...
def build_query(q='*', start='0', size='10'): return { 'query': build_query_string(q), 'from': start, 'size': size, } def build_query_string(q): return { 'query_string': { 'default_field': '_all', 'query': q, 'analyze_wildcard': True, ...
def build_query(q='*', start=0, size=10): return { 'query': build_query_string(q), 'from': start, 'size': size, } def build_query_string(q): return { 'query_string': { 'default_field': '_all', 'query': q, 'analyze_wildcard': True, ...
<commit_before>def build_query(q='*', start='0', size='10'): return { 'query': build_query_string(q), 'from': start, 'size': size, } def build_query_string(q): return { 'query_string': { 'default_field': '_all', 'query': q, 'analyze_wildc...
def build_query(q='*', start=0, size=10): return { 'query': build_query_string(q), 'from': start, 'size': size, } def build_query_string(q): return { 'query_string': { 'default_field': '_all', 'query': q, 'analyze_wildcard': True, ...
def build_query(q='*', start='0', size='10'): return { 'query': build_query_string(q), 'from': start, 'size': size, } def build_query_string(q): return { 'query_string': { 'default_field': '_all', 'query': q, 'analyze_wildcard': True, ...
<commit_before>def build_query(q='*', start='0', size='10'): return { 'query': build_query_string(q), 'from': start, 'size': size, } def build_query_string(q): return { 'query_string': { 'default_field': '_all', 'query': q, 'analyze_wildc...
5f332ba0d67607c99feae5af2fea177da588076f
addons/bestja_configuration_ucw/__openerp__.py
addons/bestja_configuration_ucw/__openerp__.py
# -*- coding: utf-8 -*- { 'name': "Bestja: UCW", 'summary': "Installation configuration for UCW", 'description': "Installation configuration for Uniwersyteckie Centrum Wolontariatu", 'author': "Laboratorium EE", 'website': "http://www.laboratorium.ee", 'version': '0.1', 'category': 'Specific...
# -*- coding: utf-8 -*- { 'name': "Bestja: UCW", 'summary': "Installation configuration for UCW", 'description': "Installation configuration for Uniwersyteckie Centrum Wolontariatu", 'author': "Laboratorium EE", 'website': "http://www.laboratorium.ee", 'version': '0.1', 'category': 'Specific...
Revert “Enable Odoo blog for UCW”
Revert “Enable Odoo blog for UCW” This reverts commit 4922d53f95b3f7c055afe1d0af0088b505cbc0d2.
Python
agpl-3.0
KamilWo/bestja,KrzysiekJ/bestja,KrzysiekJ/bestja,EE/bestja,EE/bestja,ludwiktrammer/bestja,ludwiktrammer/bestja,EE/bestja,KamilWo/bestja,KamilWo/bestja,ludwiktrammer/bestja,KrzysiekJ/bestja
# -*- coding: utf-8 -*- { 'name': "Bestja: UCW", 'summary': "Installation configuration for UCW", 'description': "Installation configuration for Uniwersyteckie Centrum Wolontariatu", 'author': "Laboratorium EE", 'website': "http://www.laboratorium.ee", 'version': '0.1', 'category': 'Specific...
# -*- coding: utf-8 -*- { 'name': "Bestja: UCW", 'summary': "Installation configuration for UCW", 'description': "Installation configuration for Uniwersyteckie Centrum Wolontariatu", 'author': "Laboratorium EE", 'website': "http://www.laboratorium.ee", 'version': '0.1', 'category': 'Specific...
<commit_before># -*- coding: utf-8 -*- { 'name': "Bestja: UCW", 'summary': "Installation configuration for UCW", 'description': "Installation configuration for Uniwersyteckie Centrum Wolontariatu", 'author': "Laboratorium EE", 'website': "http://www.laboratorium.ee", 'version': '0.1', 'categ...
# -*- coding: utf-8 -*- { 'name': "Bestja: UCW", 'summary': "Installation configuration for UCW", 'description': "Installation configuration for Uniwersyteckie Centrum Wolontariatu", 'author': "Laboratorium EE", 'website': "http://www.laboratorium.ee", 'version': '0.1', 'category': 'Specific...
# -*- coding: utf-8 -*- { 'name': "Bestja: UCW", 'summary': "Installation configuration for UCW", 'description': "Installation configuration for Uniwersyteckie Centrum Wolontariatu", 'author': "Laboratorium EE", 'website': "http://www.laboratorium.ee", 'version': '0.1', 'category': 'Specific...
<commit_before># -*- coding: utf-8 -*- { 'name': "Bestja: UCW", 'summary': "Installation configuration for UCW", 'description': "Installation configuration for Uniwersyteckie Centrum Wolontariatu", 'author': "Laboratorium EE", 'website': "http://www.laboratorium.ee", 'version': '0.1', 'categ...
3178a77cc6cdefeaacafbacf91c8b35308c18170
setup.py
setup.py
from setuptools import setup, find_packages version = '0.2' README = open("README.rst", "rt").read() setup(name='corneti.recipes.codeintel', version=version, description="A Sublime Text 2 / SublimeCodeIntel auto-completion data generator for buildout", long_description=README, classifiers=[ ...
from setuptools import setup, find_packages version = '0.2.1' README = open("README.rst", "rt").read() setup(name='corneti.recipes.codeintel', version=version, description="A Sublime Text 2 / SublimeCodeIntel auto-completion data generator for buildout", long_description=README, classifiers=[...
Include documentation and license in package
Include documentation and license in package
Python
mit
fabiocorneti/corneti.recipes.codeintel
from setuptools import setup, find_packages version = '0.2' README = open("README.rst", "rt").read() setup(name='corneti.recipes.codeintel', version=version, description="A Sublime Text 2 / SublimeCodeIntel auto-completion data generator for buildout", long_description=README, classifiers=[ ...
from setuptools import setup, find_packages version = '0.2.1' README = open("README.rst", "rt").read() setup(name='corneti.recipes.codeintel', version=version, description="A Sublime Text 2 / SublimeCodeIntel auto-completion data generator for buildout", long_description=README, classifiers=[...
<commit_before>from setuptools import setup, find_packages version = '0.2' README = open("README.rst", "rt").read() setup(name='corneti.recipes.codeintel', version=version, description="A Sublime Text 2 / SublimeCodeIntel auto-completion data generator for buildout", long_description=README, ...
from setuptools import setup, find_packages version = '0.2.1' README = open("README.rst", "rt").read() setup(name='corneti.recipes.codeintel', version=version, description="A Sublime Text 2 / SublimeCodeIntel auto-completion data generator for buildout", long_description=README, classifiers=[...
from setuptools import setup, find_packages version = '0.2' README = open("README.rst", "rt").read() setup(name='corneti.recipes.codeintel', version=version, description="A Sublime Text 2 / SublimeCodeIntel auto-completion data generator for buildout", long_description=README, classifiers=[ ...
<commit_before>from setuptools import setup, find_packages version = '0.2' README = open("README.rst", "rt").read() setup(name='corneti.recipes.codeintel', version=version, description="A Sublime Text 2 / SublimeCodeIntel auto-completion data generator for buildout", long_description=README, ...
ba7109a6b95ee88e4890752fdf7a878f3c45bac8
setup.py
setup.py
from setuptools import setup, find_packages setup( name='dataset', version='0.3.14', description="Toolkit for Python-based data processing.", long_description="", classifiers=[ "Development Status :: 3 - Alpha", "Intended Audience :: Developers", "License :: OSI Approved :: ...
from setuptools import setup, find_packages setup( name='dataset', version='0.3.14', description="Toolkit for Python-based data processing.", long_description="", classifiers=[ "Development Status :: 3 - Alpha", "Intended Audience :: Developers", "License :: OSI Approved :: ...
Add Py 2 and Py 3 classifiers
Add Py 2 and Py 3 classifiers
Python
mit
reubano/dataset,vguzmanp/dataset,stefanw/dataset,pudo/dataset,saimn/dataset,twds/dataset,askebos/dataset
from setuptools import setup, find_packages setup( name='dataset', version='0.3.14', description="Toolkit for Python-based data processing.", long_description="", classifiers=[ "Development Status :: 3 - Alpha", "Intended Audience :: Developers", "License :: OSI Approved :: ...
from setuptools import setup, find_packages setup( name='dataset', version='0.3.14', description="Toolkit for Python-based data processing.", long_description="", classifiers=[ "Development Status :: 3 - Alpha", "Intended Audience :: Developers", "License :: OSI Approved :: ...
<commit_before>from setuptools import setup, find_packages setup( name='dataset', version='0.3.14', description="Toolkit for Python-based data processing.", long_description="", classifiers=[ "Development Status :: 3 - Alpha", "Intended Audience :: Developers", "License :: O...
from setuptools import setup, find_packages setup( name='dataset', version='0.3.14', description="Toolkit for Python-based data processing.", long_description="", classifiers=[ "Development Status :: 3 - Alpha", "Intended Audience :: Developers", "License :: OSI Approved :: ...
from setuptools import setup, find_packages setup( name='dataset', version='0.3.14', description="Toolkit for Python-based data processing.", long_description="", classifiers=[ "Development Status :: 3 - Alpha", "Intended Audience :: Developers", "License :: OSI Approved :: ...
<commit_before>from setuptools import setup, find_packages setup( name='dataset', version='0.3.14', description="Toolkit for Python-based data processing.", long_description="", classifiers=[ "Development Status :: 3 - Alpha", "Intended Audience :: Developers", "License :: O...
bf39da891857771cdb51a2ff141b1200950084ad
setup.py
setup.py
#!/usr/bin/env python import sys from setuptools import setup from setuptools.command.test import test as TestCommand import nacl try: import nacl.nacl except ImportError: # installing - there is no cffi yet ext_modules = [] else: # building bdist - cffi is here! ext_modules = [nacl.nacl.ffi.veri...
#!/usr/bin/env python import sys from setuptools import setup from setuptools.command.test import test as TestCommand import nacl try: import nacl.nacl except ImportError: # installing - there is no cffi yet ext_modules = [] else: # building bdist - cffi is here! ext_modules = [nacl.nacl.ffi.veri...
Add clasifiers for the Python implementations and versions
Add clasifiers for the Python implementations and versions
Python
apache-2.0
dstufft/pynacl,alex/pynacl,lmctv/pynacl,lmctv/pynacl,pyca/pynacl,reaperhulk/pynacl,dstufft/pynacl,ucoin-io/cutecoin,reaperhulk/pynacl,hoffmabc/pynacl,reaperhulk/pynacl,pyca/pynacl,reaperhulk/pynacl,scholarly/pynacl,reaperhulk/pynacl,xueyumusic/pynacl,dstufft/pynacl,xueyumusic/pynacl,hoffmabc/pynacl,dstufft/pynacl,schol...
#!/usr/bin/env python import sys from setuptools import setup from setuptools.command.test import test as TestCommand import nacl try: import nacl.nacl except ImportError: # installing - there is no cffi yet ext_modules = [] else: # building bdist - cffi is here! ext_modules = [nacl.nacl.ffi.veri...
#!/usr/bin/env python import sys from setuptools import setup from setuptools.command.test import test as TestCommand import nacl try: import nacl.nacl except ImportError: # installing - there is no cffi yet ext_modules = [] else: # building bdist - cffi is here! ext_modules = [nacl.nacl.ffi.veri...
<commit_before>#!/usr/bin/env python import sys from setuptools import setup from setuptools.command.test import test as TestCommand import nacl try: import nacl.nacl except ImportError: # installing - there is no cffi yet ext_modules = [] else: # building bdist - cffi is here! ext_modules = [nac...
#!/usr/bin/env python import sys from setuptools import setup from setuptools.command.test import test as TestCommand import nacl try: import nacl.nacl except ImportError: # installing - there is no cffi yet ext_modules = [] else: # building bdist - cffi is here! ext_modules = [nacl.nacl.ffi.veri...
#!/usr/bin/env python import sys from setuptools import setup from setuptools.command.test import test as TestCommand import nacl try: import nacl.nacl except ImportError: # installing - there is no cffi yet ext_modules = [] else: # building bdist - cffi is here! ext_modules = [nacl.nacl.ffi.veri...
<commit_before>#!/usr/bin/env python import sys from setuptools import setup from setuptools.command.test import test as TestCommand import nacl try: import nacl.nacl except ImportError: # installing - there is no cffi yet ext_modules = [] else: # building bdist - cffi is here! ext_modules = [nac...
a8c480cb079c32c4f589a795e12ba4854cb831cc
setup.py
setup.py
#!/usr/bin/env python # Copyright (C) 2013 SignalFuse, Inc. # Setuptools install description file. import os from setuptools import setup, find_packages setup( name='maestro', version='0.0.1', description='Orchestrator for multi-host Docker deployments', zip_safe=True, packages=find_packages(), ...
#!/usr/bin/env python # Copyright (C) 2013 SignalFuse, Inc. # Setuptools install description file. import os from setuptools import setup, find_packages setup( name='maestro', version='0.0.1', description='Orchestrator for multi-host Docker deployments', zip_safe=True, packages=find_packages(), ...
Fix custom dependency on docker-py
Fix custom dependency on docker-py Signed-off-by: Maxime Petazzoni <[email protected]>
Python
apache-2.0
Anvil/maestro-ng,zsuzhengdu/maestro-ng,jorge-marques/maestro-ng,jorge-marques/maestro-ng,ivotron/maestro-ng,signalfuse/maestro-ng,zsuzhengdu/maestro-ng,signalfx/maestro-ng,Anvil/maestro-ng,signalfuse/maestro-ng,ivotron/maestro-ng,signalfx/maestro-ng
#!/usr/bin/env python # Copyright (C) 2013 SignalFuse, Inc. # Setuptools install description file. import os from setuptools import setup, find_packages setup( name='maestro', version='0.0.1', description='Orchestrator for multi-host Docker deployments', zip_safe=True, packages=find_packages(), ...
#!/usr/bin/env python # Copyright (C) 2013 SignalFuse, Inc. # Setuptools install description file. import os from setuptools import setup, find_packages setup( name='maestro', version='0.0.1', description='Orchestrator for multi-host Docker deployments', zip_safe=True, packages=find_packages(), ...
<commit_before>#!/usr/bin/env python # Copyright (C) 2013 SignalFuse, Inc. # Setuptools install description file. import os from setuptools import setup, find_packages setup( name='maestro', version='0.0.1', description='Orchestrator for multi-host Docker deployments', zip_safe=True, packages=fin...
#!/usr/bin/env python # Copyright (C) 2013 SignalFuse, Inc. # Setuptools install description file. import os from setuptools import setup, find_packages setup( name='maestro', version='0.0.1', description='Orchestrator for multi-host Docker deployments', zip_safe=True, packages=find_packages(), ...
#!/usr/bin/env python # Copyright (C) 2013 SignalFuse, Inc. # Setuptools install description file. import os from setuptools import setup, find_packages setup( name='maestro', version='0.0.1', description='Orchestrator for multi-host Docker deployments', zip_safe=True, packages=find_packages(), ...
<commit_before>#!/usr/bin/env python # Copyright (C) 2013 SignalFuse, Inc. # Setuptools install description file. import os from setuptools import setup, find_packages setup( name='maestro', version='0.0.1', description='Orchestrator for multi-host Docker deployments', zip_safe=True, packages=fin...
f1e48c8b50faf604e9fb42b0d4ac9524a8de6372
setup.py
setup.py
#!/usr/bin/env python try: from setuptools.core import setup except ImportError: from distutils.core import setup setup( name='django-iprestrict', version='0.2', description='Django app + middleware to restrict access to all or sections of a Django project by client IP ranges', long_descriptio...
#!/usr/bin/env python try: from setuptools.core import setup except ImportError: from distutils.core import setup setup( name='django-iprestrict', version='0.3', description='Django app + middleware to restrict access to all or sections of a Django project by client IP ranges', long_descriptio...
Bump version to 0.3, tag for 0.2 seems to exist already
Bump version to 0.3, tag for 0.2 seems to exist already
Python
bsd-3-clause
whyflyru/django-iprestrict,sociateru/django-iprestrict,sociateru/django-iprestrict,sociateru/django-iprestrict,whyflyru/django-iprestrict,sociateru/django-iprestrict,whyflyru/django-iprestrict,whyflyru/django-iprestrict,muccg/django-iprestrict,muccg/django-iprestrict,muccg/django-iprestrict
#!/usr/bin/env python try: from setuptools.core import setup except ImportError: from distutils.core import setup setup( name='django-iprestrict', version='0.2', description='Django app + middleware to restrict access to all or sections of a Django project by client IP ranges', long_descriptio...
#!/usr/bin/env python try: from setuptools.core import setup except ImportError: from distutils.core import setup setup( name='django-iprestrict', version='0.3', description='Django app + middleware to restrict access to all or sections of a Django project by client IP ranges', long_descriptio...
<commit_before>#!/usr/bin/env python try: from setuptools.core import setup except ImportError: from distutils.core import setup setup( name='django-iprestrict', version='0.2', description='Django app + middleware to restrict access to all or sections of a Django project by client IP ranges', ...
#!/usr/bin/env python try: from setuptools.core import setup except ImportError: from distutils.core import setup setup( name='django-iprestrict', version='0.3', description='Django app + middleware to restrict access to all or sections of a Django project by client IP ranges', long_descriptio...
#!/usr/bin/env python try: from setuptools.core import setup except ImportError: from distutils.core import setup setup( name='django-iprestrict', version='0.2', description='Django app + middleware to restrict access to all or sections of a Django project by client IP ranges', long_descriptio...
<commit_before>#!/usr/bin/env python try: from setuptools.core import setup except ImportError: from distutils.core import setup setup( name='django-iprestrict', version='0.2', description='Django app + middleware to restrict access to all or sections of a Django project by client IP ranges', ...
d7f0376c78859901ff567e2fcd65a3f3cd10e9d0
setup.py
setup.py
from setuptools import find_packages, setup setup(name="python-voc", version="0.0", description="A python utility for loading data in Pascal VOC format", author="Michele Pratusevich", author_email='[email protected]', platforms=["osx"], # or more specific, e.g. "win32", "cygwin", "osx" ...
from setuptools import find_packages, setup setup(name="voc_utils", version="0.0", description="A python utility for loading data in Pascal VOC format", author="Michele Pratusevich", author_email='[email protected]', platforms=["osx"], # or more specific, e.g. "win32", "cygwin", "osx" ...
Change package name to not have a dash
Change package name to not have a dash
Python
mit
mprat/pascal-voc-python
from setuptools import find_packages, setup setup(name="python-voc", version="0.0", description="A python utility for loading data in Pascal VOC format", author="Michele Pratusevich", author_email='[email protected]', platforms=["osx"], # or more specific, e.g. "win32", "cygwin", "osx" ...
from setuptools import find_packages, setup setup(name="voc_utils", version="0.0", description="A python utility for loading data in Pascal VOC format", author="Michele Pratusevich", author_email='[email protected]', platforms=["osx"], # or more specific, e.g. "win32", "cygwin", "osx" ...
<commit_before>from setuptools import find_packages, setup setup(name="python-voc", version="0.0", description="A python utility for loading data in Pascal VOC format", author="Michele Pratusevich", author_email='[email protected]', platforms=["osx"], # or more specific, e.g. "win32", "...
from setuptools import find_packages, setup setup(name="voc_utils", version="0.0", description="A python utility for loading data in Pascal VOC format", author="Michele Pratusevich", author_email='[email protected]', platforms=["osx"], # or more specific, e.g. "win32", "cygwin", "osx" ...
from setuptools import find_packages, setup setup(name="python-voc", version="0.0", description="A python utility for loading data in Pascal VOC format", author="Michele Pratusevich", author_email='[email protected]', platforms=["osx"], # or more specific, e.g. "win32", "cygwin", "osx" ...
<commit_before>from setuptools import find_packages, setup setup(name="python-voc", version="0.0", description="A python utility for loading data in Pascal VOC format", author="Michele Pratusevich", author_email='[email protected]', platforms=["osx"], # or more specific, e.g. "win32", "...
a4142dfea882c37ab1b1db14aa6e7740ed1f0103
setup.py
setup.py
#!/usr/bin/env python """Setup script for PythonTemplateDemo.""" import setuptools from demo import __project__, __version__ try: README = open("README.rst").read() CHANGELOG = open("CHANGELOG.rst").read() except IOError: LONG_DESCRIPTION = "<file not found>" else: LONG_DESCRIPTION = README + '\n' +...
#!/usr/bin/env python """Setup script for PythonTemplateDemo.""" import setuptools from demo import __project__, __version__ try: README = open("README.rst").read() CHANGELOG = open("CHANGELOG.rst").read() except IOError: LONG_DESCRIPTION = "<placeholder>" else: LONG_DESCRIPTION = README + '\n' + CH...
Deploy Travis CI build 720 to GitHub
Deploy Travis CI build 720 to GitHub
Python
mit
jacebrowning/template-python-demo
#!/usr/bin/env python """Setup script for PythonTemplateDemo.""" import setuptools from demo import __project__, __version__ try: README = open("README.rst").read() CHANGELOG = open("CHANGELOG.rst").read() except IOError: LONG_DESCRIPTION = "<file not found>" else: LONG_DESCRIPTION = README + '\n' +...
#!/usr/bin/env python """Setup script for PythonTemplateDemo.""" import setuptools from demo import __project__, __version__ try: README = open("README.rst").read() CHANGELOG = open("CHANGELOG.rst").read() except IOError: LONG_DESCRIPTION = "<placeholder>" else: LONG_DESCRIPTION = README + '\n' + CH...
<commit_before>#!/usr/bin/env python """Setup script for PythonTemplateDemo.""" import setuptools from demo import __project__, __version__ try: README = open("README.rst").read() CHANGELOG = open("CHANGELOG.rst").read() except IOError: LONG_DESCRIPTION = "<file not found>" else: LONG_DESCRIPTION = ...
#!/usr/bin/env python """Setup script for PythonTemplateDemo.""" import setuptools from demo import __project__, __version__ try: README = open("README.rst").read() CHANGELOG = open("CHANGELOG.rst").read() except IOError: LONG_DESCRIPTION = "<placeholder>" else: LONG_DESCRIPTION = README + '\n' + CH...
#!/usr/bin/env python """Setup script for PythonTemplateDemo.""" import setuptools from demo import __project__, __version__ try: README = open("README.rst").read() CHANGELOG = open("CHANGELOG.rst").read() except IOError: LONG_DESCRIPTION = "<file not found>" else: LONG_DESCRIPTION = README + '\n' +...
<commit_before>#!/usr/bin/env python """Setup script for PythonTemplateDemo.""" import setuptools from demo import __project__, __version__ try: README = open("README.rst").read() CHANGELOG = open("CHANGELOG.rst").read() except IOError: LONG_DESCRIPTION = "<file not found>" else: LONG_DESCRIPTION = ...
fa991297168f216c208d53b880124a4f23250034
setup.py
setup.py
import importlib from cx_Freeze import setup, Executable backend_path = importlib.import_module("bcrypt").__path__[0] backend_path = backend_path.replace("bcrypt", ".libs_cffi_backend") # Dependencies are automatically detected, but it might need # fine tuning. build_exe_options = { "include_files": [ ("...
import importlib from cx_Freeze import setup, Executable backend_path = importlib.import_module("bcrypt").__path__[0] backend_path = backend_path.replace("bcrypt", ".libs_cffi_backend") # Dependencies are automatically detected, but it might need # fine tuning. build_exe_options = { "include_files": [ ("...
Add gzip to cx-freeze packages
Add gzip to cx-freeze packages
Python
mit
virtool/virtool,igboyes/virtool,virtool/virtool,igboyes/virtool
import importlib from cx_Freeze import setup, Executable backend_path = importlib.import_module("bcrypt").__path__[0] backend_path = backend_path.replace("bcrypt", ".libs_cffi_backend") # Dependencies are automatically detected, but it might need # fine tuning. build_exe_options = { "include_files": [ ("...
import importlib from cx_Freeze import setup, Executable backend_path = importlib.import_module("bcrypt").__path__[0] backend_path = backend_path.replace("bcrypt", ".libs_cffi_backend") # Dependencies are automatically detected, but it might need # fine tuning. build_exe_options = { "include_files": [ ("...
<commit_before>import importlib from cx_Freeze import setup, Executable backend_path = importlib.import_module("bcrypt").__path__[0] backend_path = backend_path.replace("bcrypt", ".libs_cffi_backend") # Dependencies are automatically detected, but it might need # fine tuning. build_exe_options = { "include_files...
import importlib from cx_Freeze import setup, Executable backend_path = importlib.import_module("bcrypt").__path__[0] backend_path = backend_path.replace("bcrypt", ".libs_cffi_backend") # Dependencies are automatically detected, but it might need # fine tuning. build_exe_options = { "include_files": [ ("...
import importlib from cx_Freeze import setup, Executable backend_path = importlib.import_module("bcrypt").__path__[0] backend_path = backend_path.replace("bcrypt", ".libs_cffi_backend") # Dependencies are automatically detected, but it might need # fine tuning. build_exe_options = { "include_files": [ ("...
<commit_before>import importlib from cx_Freeze import setup, Executable backend_path = importlib.import_module("bcrypt").__path__[0] backend_path = backend_path.replace("bcrypt", ".libs_cffi_backend") # Dependencies are automatically detected, but it might need # fine tuning. build_exe_options = { "include_files...
a735cf90640899bc83a57f7b079b100f61f56e41
setup.py
setup.py
from distutils.core import setup from os.path import exists setup( name = "fsmonitor", version = "0.1", description = "Filesystem monitoring", long_description=(open('README.rst').read() if exists('README.rst') else ''), author = "Luke McCarthy", author_email = "luke@iogop...
from distutils.core import setup from os.path import exists from platform import system requires = [] if system == "Windows": requires = ["pypiwin32"] setup( name = "fsmonitor", version = "0.1", description = "Filesystem monitoring", long_description=(open('README.rst').read() if exists('README.rs...
Add requires pywin32 only for Windows
Add requires pywin32 only for Windows
Python
mit
shaurz/fsmonitor
from distutils.core import setup from os.path import exists setup( name = "fsmonitor", version = "0.1", description = "Filesystem monitoring", long_description=(open('README.rst').read() if exists('README.rst') else ''), author = "Luke McCarthy", author_email = "luke@iogop...
from distutils.core import setup from os.path import exists from platform import system requires = [] if system == "Windows": requires = ["pypiwin32"] setup( name = "fsmonitor", version = "0.1", description = "Filesystem monitoring", long_description=(open('README.rst').read() if exists('README.rs...
<commit_before>from distutils.core import setup from os.path import exists setup( name = "fsmonitor", version = "0.1", description = "Filesystem monitoring", long_description=(open('README.rst').read() if exists('README.rst') else ''), author = "Luke McCarthy", author_emai...
from distutils.core import setup from os.path import exists from platform import system requires = [] if system == "Windows": requires = ["pypiwin32"] setup( name = "fsmonitor", version = "0.1", description = "Filesystem monitoring", long_description=(open('README.rst').read() if exists('README.rs...
from distutils.core import setup from os.path import exists setup( name = "fsmonitor", version = "0.1", description = "Filesystem monitoring", long_description=(open('README.rst').read() if exists('README.rst') else ''), author = "Luke McCarthy", author_email = "luke@iogop...
<commit_before>from distutils.core import setup from os.path import exists setup( name = "fsmonitor", version = "0.1", description = "Filesystem monitoring", long_description=(open('README.rst').read() if exists('README.rst') else ''), author = "Luke McCarthy", author_emai...
ec06de04a6696894e3058ca00e53c13ad441b357
setup.py
setup.py
from distutils.core import setup setup( name="simple_slack_bot", packages=["simple_slack_bot"], # this must be the same as the name above version="1.3.0", description="Simple Slack Bot makes writing your next Slack bot incredibly easy", long_description="Simple Slack Bot makes writing your next Sl...
from distutils.core import setup setup( name="simple_slack_bot", packages=["simple_slack_bot"], # this must be the same as the name above version="1.3.1", description="Simple Slack Bot makes writing your next Slack bot incredibly easy", long_description="Simple Slack Bot makes writing your next Sl...
Increment that pip package version to 1.3.1
Increment that pip package version to 1.3.1 I incremented the last value as I am suggesting that not requiring certain pip dependencies put the project into a bad state... Some may consider that a bug. Either way :)
Python
mit
GregHilston/Simple-Slack-Bot
from distutils.core import setup setup( name="simple_slack_bot", packages=["simple_slack_bot"], # this must be the same as the name above version="1.3.0", description="Simple Slack Bot makes writing your next Slack bot incredibly easy", long_description="Simple Slack Bot makes writing your next Sl...
from distutils.core import setup setup( name="simple_slack_bot", packages=["simple_slack_bot"], # this must be the same as the name above version="1.3.1", description="Simple Slack Bot makes writing your next Slack bot incredibly easy", long_description="Simple Slack Bot makes writing your next Sl...
<commit_before>from distutils.core import setup setup( name="simple_slack_bot", packages=["simple_slack_bot"], # this must be the same as the name above version="1.3.0", description="Simple Slack Bot makes writing your next Slack bot incredibly easy", long_description="Simple Slack Bot makes writi...
from distutils.core import setup setup( name="simple_slack_bot", packages=["simple_slack_bot"], # this must be the same as the name above version="1.3.1", description="Simple Slack Bot makes writing your next Slack bot incredibly easy", long_description="Simple Slack Bot makes writing your next Sl...
from distutils.core import setup setup( name="simple_slack_bot", packages=["simple_slack_bot"], # this must be the same as the name above version="1.3.0", description="Simple Slack Bot makes writing your next Slack bot incredibly easy", long_description="Simple Slack Bot makes writing your next Sl...
<commit_before>from distutils.core import setup setup( name="simple_slack_bot", packages=["simple_slack_bot"], # this must be the same as the name above version="1.3.0", description="Simple Slack Bot makes writing your next Slack bot incredibly easy", long_description="Simple Slack Bot makes writi...
ffe553cf7651ab23fd5faa6c9f8525004a9b8fda
setup.py
setup.py
import os from setuptools import setup README = open(os.path.join(os.path.dirname(__file__), 'README.md')).read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='django-swiftbrowser', version='0.21', packages=['swiftbrow...
import os from setuptools import setup README = open(os.path.join(os.path.dirname(__file__), 'README.md')).read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='django-swiftbrowser', version='0.22', packages=['swiftbrow...
Fix bug when creating temporary URLs
Fix bug when creating temporary URLs Pythons HMAC does not accept unicode, therefore converting key and hmac body to string (to be compatible with Python 2.x). Python 3 needs a byte conversion. See also: http://bugs.python.org/issue5285
Python
apache-2.0
honza801/django-swiftbrowser,cschwede/django-swiftbrowser,honza801/django-swiftbrowser,cschwede/django-swiftbrowser,honza801/django-swiftbrowser
import os from setuptools import setup README = open(os.path.join(os.path.dirname(__file__), 'README.md')).read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='django-swiftbrowser', version='0.21', packages=['swiftbrow...
import os from setuptools import setup README = open(os.path.join(os.path.dirname(__file__), 'README.md')).read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='django-swiftbrowser', version='0.22', packages=['swiftbrow...
<commit_before>import os from setuptools import setup README = open(os.path.join(os.path.dirname(__file__), 'README.md')).read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='django-swiftbrowser', version='0.21', packa...
import os from setuptools import setup README = open(os.path.join(os.path.dirname(__file__), 'README.md')).read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='django-swiftbrowser', version='0.22', packages=['swiftbrow...
import os from setuptools import setup README = open(os.path.join(os.path.dirname(__file__), 'README.md')).read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='django-swiftbrowser', version='0.21', packages=['swiftbrow...
<commit_before>import os from setuptools import setup README = open(os.path.join(os.path.dirname(__file__), 'README.md')).read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='django-swiftbrowser', version='0.21', packa...
6ac11b95a10d8078774d3832aefb47ca3829d787
setup.py
setup.py
#!/usr/bin/env python from distutils.core import setup setup(name='redis-dump-load', version='0.4.0', description='Dump and load redis databases', author='Oleg Pudeyev', author_email='[email protected]', url='http://github.com/p/redis-dump-load', py_modules=['redisdl'], data_files=['LICENS...
#!/usr/bin/env python import os.path from distutils.core import setup package_name = 'redis-dump-load' package_version = '0.4.0' doc_dir = os.path.join('share', 'doc', package_name) data_files = ['LICENSE', 'README.rst'] setup(name=package_name, version=package_version, description='Dump and load redis dat...
Put data files in doc dir
Put data files in doc dir
Python
bsd-2-clause
p/redis-dump-load,p/redis-dump-load
#!/usr/bin/env python from distutils.core import setup setup(name='redis-dump-load', version='0.4.0', description='Dump and load redis databases', author='Oleg Pudeyev', author_email='[email protected]', url='http://github.com/p/redis-dump-load', py_modules=['redisdl'], data_files=['LICENS...
#!/usr/bin/env python import os.path from distutils.core import setup package_name = 'redis-dump-load' package_version = '0.4.0' doc_dir = os.path.join('share', 'doc', package_name) data_files = ['LICENSE', 'README.rst'] setup(name=package_name, version=package_version, description='Dump and load redis dat...
<commit_before>#!/usr/bin/env python from distutils.core import setup setup(name='redis-dump-load', version='0.4.0', description='Dump and load redis databases', author='Oleg Pudeyev', author_email='[email protected]', url='http://github.com/p/redis-dump-load', py_modules=['redisdl'], data...
#!/usr/bin/env python import os.path from distutils.core import setup package_name = 'redis-dump-load' package_version = '0.4.0' doc_dir = os.path.join('share', 'doc', package_name) data_files = ['LICENSE', 'README.rst'] setup(name=package_name, version=package_version, description='Dump and load redis dat...
#!/usr/bin/env python from distutils.core import setup setup(name='redis-dump-load', version='0.4.0', description='Dump and load redis databases', author='Oleg Pudeyev', author_email='[email protected]', url='http://github.com/p/redis-dump-load', py_modules=['redisdl'], data_files=['LICENS...
<commit_before>#!/usr/bin/env python from distutils.core import setup setup(name='redis-dump-load', version='0.4.0', description='Dump and load redis databases', author='Oleg Pudeyev', author_email='[email protected]', url='http://github.com/p/redis-dump-load', py_modules=['redisdl'], data...
765e060897d7823547098d76afbfa72c0fdb191c
setup.py
setup.py
# # Initially copied from: # https://raw.githubusercontent.com/pypa/sampleproject/master/setup.py # from setuptools import setup, find_packages import os import codecs import __active_directory_version__ as __version__ here = os.path.abspath(os.path.dirname(__file__)) with codecs.open(os.path.join(here, ...
# # Initially copied from: # https://raw.githubusercontent.com/pypa/sampleproject/master/setup.py # from setuptools import setup, find_packages import os import codecs import __active_directory_version__ as _version here = os.path.abspath(os.path.dirname(__file__)) with codecs.open(os.path.join(here, 'RE...
Sort out the mess with the version
Sort out the mess with the version
Python
mit
tjguk/active_directory
# # Initially copied from: # https://raw.githubusercontent.com/pypa/sampleproject/master/setup.py # from setuptools import setup, find_packages import os import codecs import __active_directory_version__ as __version__ here = os.path.abspath(os.path.dirname(__file__)) with codecs.open(os.path.join(here, ...
# # Initially copied from: # https://raw.githubusercontent.com/pypa/sampleproject/master/setup.py # from setuptools import setup, find_packages import os import codecs import __active_directory_version__ as _version here = os.path.abspath(os.path.dirname(__file__)) with codecs.open(os.path.join(here, 'RE...
<commit_before># # Initially copied from: # https://raw.githubusercontent.com/pypa/sampleproject/master/setup.py # from setuptools import setup, find_packages import os import codecs import __active_directory_version__ as __version__ here = os.path.abspath(os.path.dirname(__file__)) with codecs.open(os.p...
# # Initially copied from: # https://raw.githubusercontent.com/pypa/sampleproject/master/setup.py # from setuptools import setup, find_packages import os import codecs import __active_directory_version__ as _version here = os.path.abspath(os.path.dirname(__file__)) with codecs.open(os.path.join(here, 'RE...
# # Initially copied from: # https://raw.githubusercontent.com/pypa/sampleproject/master/setup.py # from setuptools import setup, find_packages import os import codecs import __active_directory_version__ as __version__ here = os.path.abspath(os.path.dirname(__file__)) with codecs.open(os.path.join(here, ...
<commit_before># # Initially copied from: # https://raw.githubusercontent.com/pypa/sampleproject/master/setup.py # from setuptools import setup, find_packages import os import codecs import __active_directory_version__ as __version__ here = os.path.abspath(os.path.dirname(__file__)) with codecs.open(os.p...
5106630e2cca3b862838791535b922dc91458865
setup.py
setup.py
#!/usr/bin/env python from setuptools import setup, find_packages with open('VERSION') as version_stream: version = version_stream.read().strip() setup( name='PlayerPiano', version=version, description='Amazes your friends by running Python doctests in a fake interactive shell.', author='Peter Fe...
#!/usr/bin/env python from setuptools import setup, find_packages with open('VERSION') as version_stream: version = version_stream.read().strip() with open('README.rst') as readme_stream: readme = readme_stream.read() setup( name='PlayerPiano', version=version, description='Amazes your friends b...
Use open context to load readme (per best practices)
Use open context to load readme (per best practices)
Python
bsd-3-clause
wearpants/playerpiano
#!/usr/bin/env python from setuptools import setup, find_packages with open('VERSION') as version_stream: version = version_stream.read().strip() setup( name='PlayerPiano', version=version, description='Amazes your friends by running Python doctests in a fake interactive shell.', author='Peter Fe...
#!/usr/bin/env python from setuptools import setup, find_packages with open('VERSION') as version_stream: version = version_stream.read().strip() with open('README.rst') as readme_stream: readme = readme_stream.read() setup( name='PlayerPiano', version=version, description='Amazes your friends b...
<commit_before>#!/usr/bin/env python from setuptools import setup, find_packages with open('VERSION') as version_stream: version = version_stream.read().strip() setup( name='PlayerPiano', version=version, description='Amazes your friends by running Python doctests in a fake interactive shell.', a...
#!/usr/bin/env python from setuptools import setup, find_packages with open('VERSION') as version_stream: version = version_stream.read().strip() with open('README.rst') as readme_stream: readme = readme_stream.read() setup( name='PlayerPiano', version=version, description='Amazes your friends b...
#!/usr/bin/env python from setuptools import setup, find_packages with open('VERSION') as version_stream: version = version_stream.read().strip() setup( name='PlayerPiano', version=version, description='Amazes your friends by running Python doctests in a fake interactive shell.', author='Peter Fe...
<commit_before>#!/usr/bin/env python from setuptools import setup, find_packages with open('VERSION') as version_stream: version = version_stream.read().strip() setup( name='PlayerPiano', version=version, description='Amazes your friends by running Python doctests in a fake interactive shell.', a...
0b7df5832eba167401604c895fb8cad6eb8c1722
setup.py
setup.py
""" Publish a new version: $ git tag X.Y.Z -m "Release X.Y.Z" $ git push --tags $ pip install --upgrade twine wheel $ python setup.py sdist bdist_wheel $ twine upload dist/* """ import codecs import os import sys from setuptools import setup SCHEDULE_VERSION = '0.4.0' SCHEDULE_DOWNLOAD_URL = ( 'https://github.c...
""" Publish a new version: $ git tag X.Y.Z -m "Release X.Y.Z" $ git push --tags $ pip install --upgrade twine wheel $ python setup.py sdist bdist_wheel $ twine upload dist/* """ import codecs import os import sys from setuptools import setup SCHEDULE_VERSION = '0.4.1' SCHEDULE_DOWNLOAD_URL = ( 'https://github.c...
Fix README.rst rendering on PyPI
Fix README.rst rendering on PyPI
Python
mit
dbader/schedule
""" Publish a new version: $ git tag X.Y.Z -m "Release X.Y.Z" $ git push --tags $ pip install --upgrade twine wheel $ python setup.py sdist bdist_wheel $ twine upload dist/* """ import codecs import os import sys from setuptools import setup SCHEDULE_VERSION = '0.4.0' SCHEDULE_DOWNLOAD_URL = ( 'https://github.c...
""" Publish a new version: $ git tag X.Y.Z -m "Release X.Y.Z" $ git push --tags $ pip install --upgrade twine wheel $ python setup.py sdist bdist_wheel $ twine upload dist/* """ import codecs import os import sys from setuptools import setup SCHEDULE_VERSION = '0.4.1' SCHEDULE_DOWNLOAD_URL = ( 'https://github.c...
<commit_before>""" Publish a new version: $ git tag X.Y.Z -m "Release X.Y.Z" $ git push --tags $ pip install --upgrade twine wheel $ python setup.py sdist bdist_wheel $ twine upload dist/* """ import codecs import os import sys from setuptools import setup SCHEDULE_VERSION = '0.4.0' SCHEDULE_DOWNLOAD_URL = ( 'h...
""" Publish a new version: $ git tag X.Y.Z -m "Release X.Y.Z" $ git push --tags $ pip install --upgrade twine wheel $ python setup.py sdist bdist_wheel $ twine upload dist/* """ import codecs import os import sys from setuptools import setup SCHEDULE_VERSION = '0.4.1' SCHEDULE_DOWNLOAD_URL = ( 'https://github.c...
""" Publish a new version: $ git tag X.Y.Z -m "Release X.Y.Z" $ git push --tags $ pip install --upgrade twine wheel $ python setup.py sdist bdist_wheel $ twine upload dist/* """ import codecs import os import sys from setuptools import setup SCHEDULE_VERSION = '0.4.0' SCHEDULE_DOWNLOAD_URL = ( 'https://github.c...
<commit_before>""" Publish a new version: $ git tag X.Y.Z -m "Release X.Y.Z" $ git push --tags $ pip install --upgrade twine wheel $ python setup.py sdist bdist_wheel $ twine upload dist/* """ import codecs import os import sys from setuptools import setup SCHEDULE_VERSION = '0.4.0' SCHEDULE_DOWNLOAD_URL = ( 'h...
9b72a221461c05b6c395f28e5b3d241afa156820
setup.py
setup.py
#!/usr/bin/env python from setuptools import setup def read(name): from os import path return open(path.join(path.dirname(__file__), name)).read() setup( name='django-facebook-auth', version='3.6.0', description="Authorisation app for Facebook API.", long_description=read("README.rst"), m...
#!/usr/bin/env python from setuptools import setup def read(name): from os import path return open(path.join(path.dirname(__file__), name)).read() setup( name='django-facebook-auth', version='3.6.1', description="Authorisation app for Facebook API.", long_description=read("README.rst"), m...
Include south migration in package.
Include south migration in package.
Python
mit
jgoclawski/django-facebook-auth,jgoclawski/django-facebook-auth,pozytywnie/django-facebook-auth,pozytywnie/django-facebook-auth
#!/usr/bin/env python from setuptools import setup def read(name): from os import path return open(path.join(path.dirname(__file__), name)).read() setup( name='django-facebook-auth', version='3.6.0', description="Authorisation app for Facebook API.", long_description=read("README.rst"), m...
#!/usr/bin/env python from setuptools import setup def read(name): from os import path return open(path.join(path.dirname(__file__), name)).read() setup( name='django-facebook-auth', version='3.6.1', description="Authorisation app for Facebook API.", long_description=read("README.rst"), m...
<commit_before>#!/usr/bin/env python from setuptools import setup def read(name): from os import path return open(path.join(path.dirname(__file__), name)).read() setup( name='django-facebook-auth', version='3.6.0', description="Authorisation app for Facebook API.", long_description=read("READ...
#!/usr/bin/env python from setuptools import setup def read(name): from os import path return open(path.join(path.dirname(__file__), name)).read() setup( name='django-facebook-auth', version='3.6.1', description="Authorisation app for Facebook API.", long_description=read("README.rst"), m...
#!/usr/bin/env python from setuptools import setup def read(name): from os import path return open(path.join(path.dirname(__file__), name)).read() setup( name='django-facebook-auth', version='3.6.0', description="Authorisation app for Facebook API.", long_description=read("README.rst"), m...
<commit_before>#!/usr/bin/env python from setuptools import setup def read(name): from os import path return open(path.join(path.dirname(__file__), name)).read() setup( name='django-facebook-auth', version='3.6.0', description="Authorisation app for Facebook API.", long_description=read("READ...
798d62dc45916b691b2e47ace649771b7de13ba0
setup.py
setup.py
import os from setuptools import find_packages, setup with open(os.path.join(os.path.dirname(__file__), 'README.rst')) as readme: README = readme.read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='wagtail-tinify', ve...
import os from setuptools import find_packages, setup with open(os.path.join(os.path.dirname(__file__), 'README.rst')) as readme: README = readme.read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='wagtail-tinify', ve...
Remove specific versions of dependencies
Remove specific versions of dependencies
Python
mit
overcastsoftware/wagtail-tinify
import os from setuptools import find_packages, setup with open(os.path.join(os.path.dirname(__file__), 'README.rst')) as readme: README = readme.read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='wagtail-tinify', ve...
import os from setuptools import find_packages, setup with open(os.path.join(os.path.dirname(__file__), 'README.rst')) as readme: README = readme.read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='wagtail-tinify', ve...
<commit_before>import os from setuptools import find_packages, setup with open(os.path.join(os.path.dirname(__file__), 'README.rst')) as readme: README = readme.read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='wagtail-...
import os from setuptools import find_packages, setup with open(os.path.join(os.path.dirname(__file__), 'README.rst')) as readme: README = readme.read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='wagtail-tinify', ve...
import os from setuptools import find_packages, setup with open(os.path.join(os.path.dirname(__file__), 'README.rst')) as readme: README = readme.read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='wagtail-tinify', ve...
<commit_before>import os from setuptools import find_packages, setup with open(os.path.join(os.path.dirname(__file__), 'README.rst')) as readme: README = readme.read() # allow setup.py to be run from any path os.chdir(os.path.normpath(os.path.join(os.path.abspath(__file__), os.pardir))) setup( name='wagtail-...
56d34a3b12fc65f291d6779a5a0e5e84036f52be
setup.py
setup.py
""" pypebbleapi ------------ Pebble-api for python. Library to ease the access to the Pebble Timeline and the creation of Pins. """ from setuptools import setup, find_packages setup( name='pypebbleapi', version='0.1.0', url='https://github.com/youtux/pypebbleapi', license='MIT', author='Alessio B...
""" pypebbleapi ------------ Pebble-api for python. Library to ease the access to the Pebble Timeline and the creation of Pins. """ from setuptools import setup, find_packages setup( name='pypebbleapi', version='0.1.0', url='https://github.com/youtux/pypebbleapi', license='MIT', author='Alessio B...
Declare support for python 3.5
Declare support for python 3.5
Python
mit
youtux/pypebbleapi
""" pypebbleapi ------------ Pebble-api for python. Library to ease the access to the Pebble Timeline and the creation of Pins. """ from setuptools import setup, find_packages setup( name='pypebbleapi', version='0.1.0', url='https://github.com/youtux/pypebbleapi', license='MIT', author='Alessio B...
""" pypebbleapi ------------ Pebble-api for python. Library to ease the access to the Pebble Timeline and the creation of Pins. """ from setuptools import setup, find_packages setup( name='pypebbleapi', version='0.1.0', url='https://github.com/youtux/pypebbleapi', license='MIT', author='Alessio B...
<commit_before>""" pypebbleapi ------------ Pebble-api for python. Library to ease the access to the Pebble Timeline and the creation of Pins. """ from setuptools import setup, find_packages setup( name='pypebbleapi', version='0.1.0', url='https://github.com/youtux/pypebbleapi', license='MIT', au...
""" pypebbleapi ------------ Pebble-api for python. Library to ease the access to the Pebble Timeline and the creation of Pins. """ from setuptools import setup, find_packages setup( name='pypebbleapi', version='0.1.0', url='https://github.com/youtux/pypebbleapi', license='MIT', author='Alessio B...
""" pypebbleapi ------------ Pebble-api for python. Library to ease the access to the Pebble Timeline and the creation of Pins. """ from setuptools import setup, find_packages setup( name='pypebbleapi', version='0.1.0', url='https://github.com/youtux/pypebbleapi', license='MIT', author='Alessio B...
<commit_before>""" pypebbleapi ------------ Pebble-api for python. Library to ease the access to the Pebble Timeline and the creation of Pins. """ from setuptools import setup, find_packages setup( name='pypebbleapi', version='0.1.0', url='https://github.com/youtux/pypebbleapi', license='MIT', au...
b6d5f0551a53cc9d97a8b5f634ec54cd9b85bf00
setup.py
setup.py
#!/usr/local/bin/python -u __author__ = 'Oliver Ratzesberger <https://github.com/fxstein>' __copyright__ = 'Copyright (C) 2015 Oliver Ratzesberger' __license__ = 'Apache License, Version 2.0' # Make sure we have access to SentientHome commons import os print 'Checking node.js presence:' if 0 != os.system('node -...
#!/usr/local/bin/python -u __author__ = 'Oliver Ratzesberger <https://github.com/fxstein>' __copyright__ = 'Copyright (C) 2015 Oliver Ratzesberger' __license__ = 'Apache License, Version 2.0' # Make sure we have access to SentientHome commons import os print 'Checking node.js presence:' if 0 != os.system('node -...
Add installation of some python 3 packages
Add installation of some python 3 packages
Python
apache-2.0
fxstein/SentientHome
#!/usr/local/bin/python -u __author__ = 'Oliver Ratzesberger <https://github.com/fxstein>' __copyright__ = 'Copyright (C) 2015 Oliver Ratzesberger' __license__ = 'Apache License, Version 2.0' # Make sure we have access to SentientHome commons import os print 'Checking node.js presence:' if 0 != os.system('node -...
#!/usr/local/bin/python -u __author__ = 'Oliver Ratzesberger <https://github.com/fxstein>' __copyright__ = 'Copyright (C) 2015 Oliver Ratzesberger' __license__ = 'Apache License, Version 2.0' # Make sure we have access to SentientHome commons import os print 'Checking node.js presence:' if 0 != os.system('node -...
<commit_before>#!/usr/local/bin/python -u __author__ = 'Oliver Ratzesberger <https://github.com/fxstein>' __copyright__ = 'Copyright (C) 2015 Oliver Ratzesberger' __license__ = 'Apache License, Version 2.0' # Make sure we have access to SentientHome commons import os print 'Checking node.js presence:' if 0 != os...
#!/usr/local/bin/python -u __author__ = 'Oliver Ratzesberger <https://github.com/fxstein>' __copyright__ = 'Copyright (C) 2015 Oliver Ratzesberger' __license__ = 'Apache License, Version 2.0' # Make sure we have access to SentientHome commons import os print 'Checking node.js presence:' if 0 != os.system('node -...
#!/usr/local/bin/python -u __author__ = 'Oliver Ratzesberger <https://github.com/fxstein>' __copyright__ = 'Copyright (C) 2015 Oliver Ratzesberger' __license__ = 'Apache License, Version 2.0' # Make sure we have access to SentientHome commons import os print 'Checking node.js presence:' if 0 != os.system('node -...
<commit_before>#!/usr/local/bin/python -u __author__ = 'Oliver Ratzesberger <https://github.com/fxstein>' __copyright__ = 'Copyright (C) 2015 Oliver Ratzesberger' __license__ = 'Apache License, Version 2.0' # Make sure we have access to SentientHome commons import os print 'Checking node.js presence:' if 0 != os...
5a648d2125deb4e5b7e62369378d8fa5c13818e6
setup.py
setup.py
from setuptools import setup setup( name='aufmachen', version='0.1-dev', url='http://github.com/fdb/aufmachen', license='BSD', author='Frederik & Jan De Bleser', description='Turns a website\'s HTML into nice, clean objects.', packages=['aufmachen', 'aufmachen.websites'], package_data =...
from setuptools import setup setup( name='aufmachen', version='0.2.1', url='http://github.com/fdb/aufmachen', license='BSD', author='Frederik & Jan De Bleser', author_email='[email protected]', description='Turns a website\'s HTML into nice, clean objects.', packages=['aufmachen', ...
Change version number, add author email.
Change version number, add author email.
Python
bsd-2-clause
fdb/aufmachen,fdb/aufmachen
from setuptools import setup setup( name='aufmachen', version='0.1-dev', url='http://github.com/fdb/aufmachen', license='BSD', author='Frederik & Jan De Bleser', description='Turns a website\'s HTML into nice, clean objects.', packages=['aufmachen', 'aufmachen.websites'], package_data =...
from setuptools import setup setup( name='aufmachen', version='0.2.1', url='http://github.com/fdb/aufmachen', license='BSD', author='Frederik & Jan De Bleser', author_email='[email protected]', description='Turns a website\'s HTML into nice, clean objects.', packages=['aufmachen', ...
<commit_before>from setuptools import setup setup( name='aufmachen', version='0.1-dev', url='http://github.com/fdb/aufmachen', license='BSD', author='Frederik & Jan De Bleser', description='Turns a website\'s HTML into nice, clean objects.', packages=['aufmachen', 'aufmachen.websites'], ...
from setuptools import setup setup( name='aufmachen', version='0.2.1', url='http://github.com/fdb/aufmachen', license='BSD', author='Frederik & Jan De Bleser', author_email='[email protected]', description='Turns a website\'s HTML into nice, clean objects.', packages=['aufmachen', ...
from setuptools import setup setup( name='aufmachen', version='0.1-dev', url='http://github.com/fdb/aufmachen', license='BSD', author='Frederik & Jan De Bleser', description='Turns a website\'s HTML into nice, clean objects.', packages=['aufmachen', 'aufmachen.websites'], package_data =...
<commit_before>from setuptools import setup setup( name='aufmachen', version='0.1-dev', url='http://github.com/fdb/aufmachen', license='BSD', author='Frederik & Jan De Bleser', description='Turns a website\'s HTML into nice, clean objects.', packages=['aufmachen', 'aufmachen.websites'], ...
2e3e2dc66add761c228e0cc685dc808bddd1952e
spicedham/backend.py
spicedham/backend.py
from config import config class BackendNotRecognizedException(Exception): """Possible backends are "sqlalchemy", "elasticsearch", and "djangoorm""""" pass if config['backend'] == 'sqlalchemy': from sqlalchemywrapper.sqlalchemywrapper import SqlAlchemyWrapper as Backend elif config['backend'] == 'elastics...
from spicedham.config import config from sqlalchemywrapper import SqlAlchemyWrapper #from elasticsearchwrapper import ElasticSearchWrapper #from djangoormwrapper import DjangoOrmWrapper class BackendNotRecognizedException(Exception): """Possible backends are "sqlalchemy", "elasticsearch", and "djangoorm""""" ...
Fix imports and duck typing
Fix imports and duck typing * Always import all backends * Only assign the right one to Backend based off the config * Fix the config import
Python
mpl-2.0
mozilla/spicedham,mozilla/spicedham
from config import config class BackendNotRecognizedException(Exception): """Possible backends are "sqlalchemy", "elasticsearch", and "djangoorm""""" pass if config['backend'] == 'sqlalchemy': from sqlalchemywrapper.sqlalchemywrapper import SqlAlchemyWrapper as Backend elif config['backend'] == 'elastics...
from spicedham.config import config from sqlalchemywrapper import SqlAlchemyWrapper #from elasticsearchwrapper import ElasticSearchWrapper #from djangoormwrapper import DjangoOrmWrapper class BackendNotRecognizedException(Exception): """Possible backends are "sqlalchemy", "elasticsearch", and "djangoorm""""" ...
<commit_before>from config import config class BackendNotRecognizedException(Exception): """Possible backends are "sqlalchemy", "elasticsearch", and "djangoorm""""" pass if config['backend'] == 'sqlalchemy': from sqlalchemywrapper.sqlalchemywrapper import SqlAlchemyWrapper as Backend elif config['backend...
from spicedham.config import config from sqlalchemywrapper import SqlAlchemyWrapper #from elasticsearchwrapper import ElasticSearchWrapper #from djangoormwrapper import DjangoOrmWrapper class BackendNotRecognizedException(Exception): """Possible backends are "sqlalchemy", "elasticsearch", and "djangoorm""""" ...
from config import config class BackendNotRecognizedException(Exception): """Possible backends are "sqlalchemy", "elasticsearch", and "djangoorm""""" pass if config['backend'] == 'sqlalchemy': from sqlalchemywrapper.sqlalchemywrapper import SqlAlchemyWrapper as Backend elif config['backend'] == 'elastics...
<commit_before>from config import config class BackendNotRecognizedException(Exception): """Possible backends are "sqlalchemy", "elasticsearch", and "djangoorm""""" pass if config['backend'] == 'sqlalchemy': from sqlalchemywrapper.sqlalchemywrapper import SqlAlchemyWrapper as Backend elif config['backend...
787fef7c74ca46b83557edaf3bb4d0189a586204
build.py
build.py
from elixir.compilers import ModelCompiler from elixir.processors import NevermoreProcessor ModelCompiler("src/", "model.rbxmx", NevermoreProcessor).compile()
from elixir.compilers import ModelCompiler ModelCompiler("src/", "model.rbxmx").compile()
Remove the use of the Nevermore processor
Remove the use of the Nevermore processor
Python
mit
VoxelDavid/echo-ridge
from elixir.compilers import ModelCompiler from elixir.processors import NevermoreProcessor ModelCompiler("src/", "model.rbxmx", NevermoreProcessor).compile() Remove the use of the Nevermore processor
from elixir.compilers import ModelCompiler ModelCompiler("src/", "model.rbxmx").compile()
<commit_before>from elixir.compilers import ModelCompiler from elixir.processors import NevermoreProcessor ModelCompiler("src/", "model.rbxmx", NevermoreProcessor).compile() <commit_msg>Remove the use of the Nevermore processor<commit_after>
from elixir.compilers import ModelCompiler ModelCompiler("src/", "model.rbxmx").compile()
from elixir.compilers import ModelCompiler from elixir.processors import NevermoreProcessor ModelCompiler("src/", "model.rbxmx", NevermoreProcessor).compile() Remove the use of the Nevermore processorfrom elixir.compilers import ModelCompiler ModelCompiler("src/", "model.rbxmx").compile()
<commit_before>from elixir.compilers import ModelCompiler from elixir.processors import NevermoreProcessor ModelCompiler("src/", "model.rbxmx", NevermoreProcessor).compile() <commit_msg>Remove the use of the Nevermore processor<commit_after>from elixir.compilers import ModelCompiler ModelCompiler("src/", "model.rbxmx...
2d73c633f3d21f0b9ff5d80eebdfca9a48a478f5
babyonboard/api/tests/test_models.py
babyonboard/api/tests/test_models.py
from django.test import TestCase from ..models import Temperature class TemperatureTest(TestCase): """Test class for temperature model""" def setUp(self): Temperature.objects.create(temperature=20.5) def test_create_temperature(self): temperature = Temperature.objects.get(temperature=20....
from django.test import TestCase from ..models import Temperature, HeartBeats class TemperatureTest(TestCase): """Test class for temperature model""" def setUp(self): Temperature.objects.create(temperature=20.5) def test_create_temperature(self): temperature = Temperature.objects.get(tem...
Implement tests for heartbeats model
Implement tests for heartbeats model
Python
mit
BabyOnBoard/BabyOnBoard-API,BabyOnBoard/BabyOnBoard-API
from django.test import TestCase from ..models import Temperature class TemperatureTest(TestCase): """Test class for temperature model""" def setUp(self): Temperature.objects.create(temperature=20.5) def test_create_temperature(self): temperature = Temperature.objects.get(temperature=20....
from django.test import TestCase from ..models import Temperature, HeartBeats class TemperatureTest(TestCase): """Test class for temperature model""" def setUp(self): Temperature.objects.create(temperature=20.5) def test_create_temperature(self): temperature = Temperature.objects.get(tem...
<commit_before>from django.test import TestCase from ..models import Temperature class TemperatureTest(TestCase): """Test class for temperature model""" def setUp(self): Temperature.objects.create(temperature=20.5) def test_create_temperature(self): temperature = Temperature.objects.get(...
from django.test import TestCase from ..models import Temperature, HeartBeats class TemperatureTest(TestCase): """Test class for temperature model""" def setUp(self): Temperature.objects.create(temperature=20.5) def test_create_temperature(self): temperature = Temperature.objects.get(tem...
from django.test import TestCase from ..models import Temperature class TemperatureTest(TestCase): """Test class for temperature model""" def setUp(self): Temperature.objects.create(temperature=20.5) def test_create_temperature(self): temperature = Temperature.objects.get(temperature=20....
<commit_before>from django.test import TestCase from ..models import Temperature class TemperatureTest(TestCase): """Test class for temperature model""" def setUp(self): Temperature.objects.create(temperature=20.5) def test_create_temperature(self): temperature = Temperature.objects.get(...
4a0edb289a3a8a3195a339a1c89a444f414b8645
tm/tm.py
tm/tm.py
#!/usr/bin/python # -*- coding: utf-8 -*- import json import os import sys import argparse import tmux_wrapper as tmux __version__ = 1.0 __description__ = "A tmux wrapper featuring shortcuts and session presets." def load_session_presets(): try: file_path = os.environ["TM_SESSIONS"] except KeyError:...
#!/usr/bin/python # -*- coding: utf-8 -*- import json import os import sys import argparse import tmux_wrapper as tmux __version__ = 1.0 __description__ = "A tmux wrapper featuring shortcuts and session presets." def load_session_presets(): try: file_path = os.environ["TM_SESSIONS"] except KeyError:...
Check for all exceptions to main method
Check for all exceptions to main method
Python
mit
ethanal/tm
#!/usr/bin/python # -*- coding: utf-8 -*- import json import os import sys import argparse import tmux_wrapper as tmux __version__ = 1.0 __description__ = "A tmux wrapper featuring shortcuts and session presets." def load_session_presets(): try: file_path = os.environ["TM_SESSIONS"] except KeyError:...
#!/usr/bin/python # -*- coding: utf-8 -*- import json import os import sys import argparse import tmux_wrapper as tmux __version__ = 1.0 __description__ = "A tmux wrapper featuring shortcuts and session presets." def load_session_presets(): try: file_path = os.environ["TM_SESSIONS"] except KeyError:...
<commit_before>#!/usr/bin/python # -*- coding: utf-8 -*- import json import os import sys import argparse import tmux_wrapper as tmux __version__ = 1.0 __description__ = "A tmux wrapper featuring shortcuts and session presets." def load_session_presets(): try: file_path = os.environ["TM_SESSIONS"] e...
#!/usr/bin/python # -*- coding: utf-8 -*- import json import os import sys import argparse import tmux_wrapper as tmux __version__ = 1.0 __description__ = "A tmux wrapper featuring shortcuts and session presets." def load_session_presets(): try: file_path = os.environ["TM_SESSIONS"] except KeyError:...
#!/usr/bin/python # -*- coding: utf-8 -*- import json import os import sys import argparse import tmux_wrapper as tmux __version__ = 1.0 __description__ = "A tmux wrapper featuring shortcuts and session presets." def load_session_presets(): try: file_path = os.environ["TM_SESSIONS"] except KeyError:...
<commit_before>#!/usr/bin/python # -*- coding: utf-8 -*- import json import os import sys import argparse import tmux_wrapper as tmux __version__ = 1.0 __description__ = "A tmux wrapper featuring shortcuts and session presets." def load_session_presets(): try: file_path = os.environ["TM_SESSIONS"] e...
0eab4f3c15c8167bcc1270249921269dc20dc506
s3sync/__init__.py
s3sync/__init__.py
VERSION = (0, 1) def get_version(): version = '%s.%s' % (VERSION[0], VERSION[1]) if VERSION[2]: version = '%s.%s' % (version, VERSION[2]) return version
VERSION = (0, 1) def get_version(): version = '%s.%s' % (VERSION[0], VERSION[1]) if len(VERSION) > 2: version = '%s.%s' % (version, VERSION[2]) return version
Fix get_version() to avoid KeyError
Fix get_version() to avoid KeyError
Python
bsd-3-clause
mntan/django-s3sync,pcraciunoiu/django-s3sync
VERSION = (0, 1) def get_version(): version = '%s.%s' % (VERSION[0], VERSION[1]) if VERSION[2]: version = '%s.%s' % (version, VERSION[2]) return version Fix get_version() to avoid KeyError
VERSION = (0, 1) def get_version(): version = '%s.%s' % (VERSION[0], VERSION[1]) if len(VERSION) > 2: version = '%s.%s' % (version, VERSION[2]) return version
<commit_before>VERSION = (0, 1) def get_version(): version = '%s.%s' % (VERSION[0], VERSION[1]) if VERSION[2]: version = '%s.%s' % (version, VERSION[2]) return version <commit_msg>Fix get_version() to avoid KeyError<commit_after>
VERSION = (0, 1) def get_version(): version = '%s.%s' % (VERSION[0], VERSION[1]) if len(VERSION) > 2: version = '%s.%s' % (version, VERSION[2]) return version
VERSION = (0, 1) def get_version(): version = '%s.%s' % (VERSION[0], VERSION[1]) if VERSION[2]: version = '%s.%s' % (version, VERSION[2]) return version Fix get_version() to avoid KeyErrorVERSION = (0, 1) def get_version(): version = '%s.%s' % (VERSION[0], VERSION[1]) if len(VERSION) > 2...
<commit_before>VERSION = (0, 1) def get_version(): version = '%s.%s' % (VERSION[0], VERSION[1]) if VERSION[2]: version = '%s.%s' % (version, VERSION[2]) return version <commit_msg>Fix get_version() to avoid KeyError<commit_after>VERSION = (0, 1) def get_version(): version = '%s.%s' % (VERSIO...
8b9733eafba371350bff7f58512eac8bf42cc782
onitu/utils.py
onitu/utils.py
import time import functools import redis class Redis(redis.Redis): class RedisSession(object): def __init__(self, redis, prefix=''): self.prefix = prefix self.redis = redis def start(self, prefix): self.prefix = prefix + ':' if prefix else '' def _...
import time import functools import redis class Redis(redis.Redis): class RedisSession(object): def __init__(self, redis, prefix=''): self.prefix = prefix self.redis = redis def start(self, prefix): self.prefix = prefix + ':' if prefix else '' def _...
Replace 'basestring' by 'str' for Python 3 compatibility
Replace 'basestring' by 'str' for Python 3 compatibility
Python
mit
onitu/onitu,onitu/onitu,onitu/onitu
import time import functools import redis class Redis(redis.Redis): class RedisSession(object): def __init__(self, redis, prefix=''): self.prefix = prefix self.redis = redis def start(self, prefix): self.prefix = prefix + ':' if prefix else '' def _...
import time import functools import redis class Redis(redis.Redis): class RedisSession(object): def __init__(self, redis, prefix=''): self.prefix = prefix self.redis = redis def start(self, prefix): self.prefix = prefix + ':' if prefix else '' def _...
<commit_before>import time import functools import redis class Redis(redis.Redis): class RedisSession(object): def __init__(self, redis, prefix=''): self.prefix = prefix self.redis = redis def start(self, prefix): self.prefix = prefix + ':' if prefix else ''...
import time import functools import redis class Redis(redis.Redis): class RedisSession(object): def __init__(self, redis, prefix=''): self.prefix = prefix self.redis = redis def start(self, prefix): self.prefix = prefix + ':' if prefix else '' def _...
import time import functools import redis class Redis(redis.Redis): class RedisSession(object): def __init__(self, redis, prefix=''): self.prefix = prefix self.redis = redis def start(self, prefix): self.prefix = prefix + ':' if prefix else '' def _...
<commit_before>import time import functools import redis class Redis(redis.Redis): class RedisSession(object): def __init__(self, redis, prefix=''): self.prefix = prefix self.redis = redis def start(self, prefix): self.prefix = prefix + ':' if prefix else ''...
21e76ae7d9e7679007d90e842e28df46a8c0fc97
itorch-runner.py
itorch-runner.py
# coding: utf-8 import sys, getopt import os import json import datetime from subprocess import call current_date = str(datetime.datetime.now()).replace(' ', '!') output_file_name = './tmp_itorch_exec-'+current_date+'.lua' if __name__ == "__main__": if len(sys.argv) > 0: input_file = open(sys.argv[1], 'r') wit...
# coding: utf-8 import sys, getopt import os import json import datetime from subprocess import call current_date = str(datetime.datetime.now()).replace(' ', '!') output_file_name = './tmp_itorch_exec-'+current_date+'.lua' if __name__ == "__main__": if len(sys.argv) > 0: input_file = open(sys.argv[1], 'r') wit...
Fix missing new line symbol for last line in notebook cell
Fix missing new line symbol for last line in notebook cell
Python
mit
AlexMili/itorch-runner
# coding: utf-8 import sys, getopt import os import json import datetime from subprocess import call current_date = str(datetime.datetime.now()).replace(' ', '!') output_file_name = './tmp_itorch_exec-'+current_date+'.lua' if __name__ == "__main__": if len(sys.argv) > 0: input_file = open(sys.argv[1], 'r') wit...
# coding: utf-8 import sys, getopt import os import json import datetime from subprocess import call current_date = str(datetime.datetime.now()).replace(' ', '!') output_file_name = './tmp_itorch_exec-'+current_date+'.lua' if __name__ == "__main__": if len(sys.argv) > 0: input_file = open(sys.argv[1], 'r') wit...
<commit_before># coding: utf-8 import sys, getopt import os import json import datetime from subprocess import call current_date = str(datetime.datetime.now()).replace(' ', '!') output_file_name = './tmp_itorch_exec-'+current_date+'.lua' if __name__ == "__main__": if len(sys.argv) > 0: input_file = open(sys.argv[1...
# coding: utf-8 import sys, getopt import os import json import datetime from subprocess import call current_date = str(datetime.datetime.now()).replace(' ', '!') output_file_name = './tmp_itorch_exec-'+current_date+'.lua' if __name__ == "__main__": if len(sys.argv) > 0: input_file = open(sys.argv[1], 'r') wit...
# coding: utf-8 import sys, getopt import os import json import datetime from subprocess import call current_date = str(datetime.datetime.now()).replace(' ', '!') output_file_name = './tmp_itorch_exec-'+current_date+'.lua' if __name__ == "__main__": if len(sys.argv) > 0: input_file = open(sys.argv[1], 'r') wit...
<commit_before># coding: utf-8 import sys, getopt import os import json import datetime from subprocess import call current_date = str(datetime.datetime.now()).replace(' ', '!') output_file_name = './tmp_itorch_exec-'+current_date+'.lua' if __name__ == "__main__": if len(sys.argv) > 0: input_file = open(sys.argv[1...
08c864a914b7996115f6b265cddb3c96c40e4fb5
global_functions.py
global_functions.py
import random import hashlib def get_random_id(): # generate a random unique integer random_id = random.randrange(1, 100000000) return random_id def get_attributes_from_class(instance_of_class): members = [attr for attr in dir(instance_of_class) if not callable(getattr(instance_of_cla...
import random import hashlib def get_random_id(): """generates a random integer value between 1 and 100000000 :return (int): randomly generated integer """ # generate a random unique integer random_id = random.randrange(1, 100000000) return random_id def get_attributes_from_class(ins...
Add descriptive docstring comments global functions
[UPDATE] Add descriptive docstring comments global functions
Python
mit
EinsteinCarrey/Shoppinglist,EinsteinCarrey/Shoppinglist,EinsteinCarrey/Shoppinglist
import random import hashlib def get_random_id(): # generate a random unique integer random_id = random.randrange(1, 100000000) return random_id def get_attributes_from_class(instance_of_class): members = [attr for attr in dir(instance_of_class) if not callable(getattr(instance_of_cla...
import random import hashlib def get_random_id(): """generates a random integer value between 1 and 100000000 :return (int): randomly generated integer """ # generate a random unique integer random_id = random.randrange(1, 100000000) return random_id def get_attributes_from_class(ins...
<commit_before>import random import hashlib def get_random_id(): # generate a random unique integer random_id = random.randrange(1, 100000000) return random_id def get_attributes_from_class(instance_of_class): members = [attr for attr in dir(instance_of_class) if not callable(getattr(...
import random import hashlib def get_random_id(): """generates a random integer value between 1 and 100000000 :return (int): randomly generated integer """ # generate a random unique integer random_id = random.randrange(1, 100000000) return random_id def get_attributes_from_class(ins...
import random import hashlib def get_random_id(): # generate a random unique integer random_id = random.randrange(1, 100000000) return random_id def get_attributes_from_class(instance_of_class): members = [attr for attr in dir(instance_of_class) if not callable(getattr(instance_of_cla...
<commit_before>import random import hashlib def get_random_id(): # generate a random unique integer random_id = random.randrange(1, 100000000) return random_id def get_attributes_from_class(instance_of_class): members = [attr for attr in dir(instance_of_class) if not callable(getattr(...
e9bec1aeac09dcb00fd423350f83bab82ea80ffc
connection_example.py
connection_example.py
import socket import threading import SocketServer class ThreadedTCPRequestHandler(SocketServer.BaseRequestHandler): def handle(self): data = self.request.recv(1024) cur_thread = threading.current_thread() response = "{}: {}".format(cur_thread.name, data) self.request.sendall(respo...
import socket import threading import SocketServer class ThreadedTCPRequestHandler(SocketServer.BaseRequestHandler): def handle(self): data = self.request.recv(1024) cur_thread = threading.current_thread() response = "{}: {}".format(cur_thread.name, data) self.request.sendall(respo...
Update example with 8 servers.
Update example with 8 servers.
Python
mit
Tribler/decentral-market
import socket import threading import SocketServer class ThreadedTCPRequestHandler(SocketServer.BaseRequestHandler): def handle(self): data = self.request.recv(1024) cur_thread = threading.current_thread() response = "{}: {}".format(cur_thread.name, data) self.request.sendall(respo...
import socket import threading import SocketServer class ThreadedTCPRequestHandler(SocketServer.BaseRequestHandler): def handle(self): data = self.request.recv(1024) cur_thread = threading.current_thread() response = "{}: {}".format(cur_thread.name, data) self.request.sendall(respo...
<commit_before>import socket import threading import SocketServer class ThreadedTCPRequestHandler(SocketServer.BaseRequestHandler): def handle(self): data = self.request.recv(1024) cur_thread = threading.current_thread() response = "{}: {}".format(cur_thread.name, data) self.reques...
import socket import threading import SocketServer class ThreadedTCPRequestHandler(SocketServer.BaseRequestHandler): def handle(self): data = self.request.recv(1024) cur_thread = threading.current_thread() response = "{}: {}".format(cur_thread.name, data) self.request.sendall(respo...
import socket import threading import SocketServer class ThreadedTCPRequestHandler(SocketServer.BaseRequestHandler): def handle(self): data = self.request.recv(1024) cur_thread = threading.current_thread() response = "{}: {}".format(cur_thread.name, data) self.request.sendall(respo...
<commit_before>import socket import threading import SocketServer class ThreadedTCPRequestHandler(SocketServer.BaseRequestHandler): def handle(self): data = self.request.recv(1024) cur_thread = threading.current_thread() response = "{}: {}".format(cur_thread.name, data) self.reques...
defbf149afa47910742a588292507535b2679f54
context_processors.py
context_processors.py
from django.conf import settings as django_settings from django.core.urlresolvers import resolve, reverse from django.utils.translation import activate, get_language def settings(request): return {'settings': django_settings} def alternate_seo_url(request): alternate_url = dict() path = request.path ...
from django.conf import settings as django_settings from django.core.urlresolvers import resolve, reverse from django.utils.translation import activate, get_language def settings(request): return {'settings': django_settings} def alternate_seo_url(request): alternate_url = dict() path = request.path ...
Exclude nonapp from contextprocessor of alternate_seo
Exclude nonapp from contextprocessor of alternate_seo
Python
mit
lotrekagency/djlotrek,lotrekagency/djlotrek
from django.conf import settings as django_settings from django.core.urlresolvers import resolve, reverse from django.utils.translation import activate, get_language def settings(request): return {'settings': django_settings} def alternate_seo_url(request): alternate_url = dict() path = request.path ...
from django.conf import settings as django_settings from django.core.urlresolvers import resolve, reverse from django.utils.translation import activate, get_language def settings(request): return {'settings': django_settings} def alternate_seo_url(request): alternate_url = dict() path = request.path ...
<commit_before>from django.conf import settings as django_settings from django.core.urlresolvers import resolve, reverse from django.utils.translation import activate, get_language def settings(request): return {'settings': django_settings} def alternate_seo_url(request): alternate_url = dict() path = r...
from django.conf import settings as django_settings from django.core.urlresolvers import resolve, reverse from django.utils.translation import activate, get_language def settings(request): return {'settings': django_settings} def alternate_seo_url(request): alternate_url = dict() path = request.path ...
from django.conf import settings as django_settings from django.core.urlresolvers import resolve, reverse from django.utils.translation import activate, get_language def settings(request): return {'settings': django_settings} def alternate_seo_url(request): alternate_url = dict() path = request.path ...
<commit_before>from django.conf import settings as django_settings from django.core.urlresolvers import resolve, reverse from django.utils.translation import activate, get_language def settings(request): return {'settings': django_settings} def alternate_seo_url(request): alternate_url = dict() path = r...
ed548ec91cfe65e9c3fecc9c6baa5b82486654bd
archlinux/archpack_settings.py
archlinux/archpack_settings.py
# # Biicode Arch Linux package settings. # # Check PKGBUILD_template docs for those settings and # what they mean. # def settings(): return { "version": "2.4", "release_number": "1", "arch_deps": ["cmake>=3.0.2", "zlib", "glibc", "sqlite", ...
# # Biicode Arch Linux package settings. # # Check PKGBUILD_template docs for those settings and # what they mean. # def settings(): return { "version": "2.4.1", "release_number": "1", "arch_deps": ["cmake>=3.0.2", "zlib", "glibc", "sqlite", ...
Update aur package to 2.4.1
Update aur package to 2.4.1
Python
bsd-2-clause
bowlofstew/packages,bowlofstew/packages,biicode/packages,biicode/packages
# # Biicode Arch Linux package settings. # # Check PKGBUILD_template docs for those settings and # what they mean. # def settings(): return { "version": "2.4", "release_number": "1", "arch_deps": ["cmake>=3.0.2", "zlib", "glibc", "sqlite", ...
# # Biicode Arch Linux package settings. # # Check PKGBUILD_template docs for those settings and # what they mean. # def settings(): return { "version": "2.4.1", "release_number": "1", "arch_deps": ["cmake>=3.0.2", "zlib", "glibc", "sqlite", ...
<commit_before># # Biicode Arch Linux package settings. # # Check PKGBUILD_template docs for those settings and # what they mean. # def settings(): return { "version": "2.4", "release_number": "1", "arch_deps": ["cmake>=3.0.2", "zlib", "glibc", "sq...
# # Biicode Arch Linux package settings. # # Check PKGBUILD_template docs for those settings and # what they mean. # def settings(): return { "version": "2.4.1", "release_number": "1", "arch_deps": ["cmake>=3.0.2", "zlib", "glibc", "sqlite", ...
# # Biicode Arch Linux package settings. # # Check PKGBUILD_template docs for those settings and # what they mean. # def settings(): return { "version": "2.4", "release_number": "1", "arch_deps": ["cmake>=3.0.2", "zlib", "glibc", "sqlite", ...
<commit_before># # Biicode Arch Linux package settings. # # Check PKGBUILD_template docs for those settings and # what they mean. # def settings(): return { "version": "2.4", "release_number": "1", "arch_deps": ["cmake>=3.0.2", "zlib", "glibc", "sq...
6297ae8ffd257689c41c411ce3fa13512910b657
app/timer/views.py
app/timer/views.py
from django.views.generic import ListView, CreateView from django.utils.timezone import now from timer.models import Timer, Location, Station, Moon, System from timer.forms import TimerForm class TimerCreateView(CreateView): model = Timer form_class = TimerForm class TimerListView(ListView): model = Tim...
from django.views.generic import ListView, CreateView from django.utils.timezone import now from timer.models import Timer, Location, Station, Moon, System from timer.forms import TimerForm class TimerCreateView(CreateView): model = Timer form_class = TimerForm class TimerListView(ListView): model = Tim...
Fix bad usage of a reserved word
Fix bad usage of a reserved word
Python
bsd-3-clause
nikdoof/limetime,nikdoof/limetime
from django.views.generic import ListView, CreateView from django.utils.timezone import now from timer.models import Timer, Location, Station, Moon, System from timer.forms import TimerForm class TimerCreateView(CreateView): model = Timer form_class = TimerForm class TimerListView(ListView): model = Tim...
from django.views.generic import ListView, CreateView from django.utils.timezone import now from timer.models import Timer, Location, Station, Moon, System from timer.forms import TimerForm class TimerCreateView(CreateView): model = Timer form_class = TimerForm class TimerListView(ListView): model = Tim...
<commit_before>from django.views.generic import ListView, CreateView from django.utils.timezone import now from timer.models import Timer, Location, Station, Moon, System from timer.forms import TimerForm class TimerCreateView(CreateView): model = Timer form_class = TimerForm class TimerListView(ListView): ...
from django.views.generic import ListView, CreateView from django.utils.timezone import now from timer.models import Timer, Location, Station, Moon, System from timer.forms import TimerForm class TimerCreateView(CreateView): model = Timer form_class = TimerForm class TimerListView(ListView): model = Tim...
from django.views.generic import ListView, CreateView from django.utils.timezone import now from timer.models import Timer, Location, Station, Moon, System from timer.forms import TimerForm class TimerCreateView(CreateView): model = Timer form_class = TimerForm class TimerListView(ListView): model = Tim...
<commit_before>from django.views.generic import ListView, CreateView from django.utils.timezone import now from timer.models import Timer, Location, Station, Moon, System from timer.forms import TimerForm class TimerCreateView(CreateView): model = Timer form_class = TimerForm class TimerListView(ListView): ...
072f69edbb0ee959ff3a6a5ca8e3ac6d2e9d45ad
setup.py
setup.py
#!/usr/bin/env python from setuptools import setup, find_packages # Get version string with open('gdx2py/version.py') as f: exec(f.read()) setup(name='GDX2py', version=__version__, author='Erkka Rinne', author_email='[email protected]', description='Read and write GAMS Data eXchange (GDX) fi...
#!/usr/bin/env python from setuptools import setup, find_packages # Get version string with open('gdx2py/version.py') as f: exec(f.read()) setup(name='GDX2py', version=__version__, author='Erkka Rinne', author_email='[email protected]', description='Read and write GAMS Data eXchange (GDX) fi...
Exclude tests from built distribution
Exclude tests from built distribution
Python
mit
ererkka/GDX2py
#!/usr/bin/env python from setuptools import setup, find_packages # Get version string with open('gdx2py/version.py') as f: exec(f.read()) setup(name='GDX2py', version=__version__, author='Erkka Rinne', author_email='[email protected]', description='Read and write GAMS Data eXchange (GDX) fi...
#!/usr/bin/env python from setuptools import setup, find_packages # Get version string with open('gdx2py/version.py') as f: exec(f.read()) setup(name='GDX2py', version=__version__, author='Erkka Rinne', author_email='[email protected]', description='Read and write GAMS Data eXchange (GDX) fi...
<commit_before>#!/usr/bin/env python from setuptools import setup, find_packages # Get version string with open('gdx2py/version.py') as f: exec(f.read()) setup(name='GDX2py', version=__version__, author='Erkka Rinne', author_email='[email protected]', description='Read and write GAMS Data eX...
#!/usr/bin/env python from setuptools import setup, find_packages # Get version string with open('gdx2py/version.py') as f: exec(f.read()) setup(name='GDX2py', version=__version__, author='Erkka Rinne', author_email='[email protected]', description='Read and write GAMS Data eXchange (GDX) fi...
#!/usr/bin/env python from setuptools import setup, find_packages # Get version string with open('gdx2py/version.py') as f: exec(f.read()) setup(name='GDX2py', version=__version__, author='Erkka Rinne', author_email='[email protected]', description='Read and write GAMS Data eXchange (GDX) fi...
<commit_before>#!/usr/bin/env python from setuptools import setup, find_packages # Get version string with open('gdx2py/version.py') as f: exec(f.read()) setup(name='GDX2py', version=__version__, author='Erkka Rinne', author_email='[email protected]', description='Read and write GAMS Data eX...
5bfaf83045587e5c7d1d70bf98b3b1eb1a1d10ed
setup.py
setup.py
from setuptools import setup setup( name='pytest-ui', description='Text User Interface for running python tests', version='0.1', license='MIT', platforms=['linux', 'osx', 'win32'], packages=['pytui'], url='https://github.com/martinsmid/pytest-ui', author_email='[email protected]', ...
from setuptools import setup setup( name='pytest-ui', description='Text User Interface for running python tests', version='0.1', license='MIT', platforms=['linux', 'osx', 'win32'], packages=['pytui'], url='https://github.com/martinsmid/pytest-ui', author_email='[email protected]', ...
Split requires into own string
Split requires into own string
Python
mit
martinsmid/pytest-ui
from setuptools import setup setup( name='pytest-ui', description='Text User Interface for running python tests', version='0.1', license='MIT', platforms=['linux', 'osx', 'win32'], packages=['pytui'], url='https://github.com/martinsmid/pytest-ui', author_email='[email protected]', ...
from setuptools import setup setup( name='pytest-ui', description='Text User Interface for running python tests', version='0.1', license='MIT', platforms=['linux', 'osx', 'win32'], packages=['pytui'], url='https://github.com/martinsmid/pytest-ui', author_email='[email protected]', ...
<commit_before>from setuptools import setup setup( name='pytest-ui', description='Text User Interface for running python tests', version='0.1', license='MIT', platforms=['linux', 'osx', 'win32'], packages=['pytui'], url='https://github.com/martinsmid/pytest-ui', author_email='martin.smi...
from setuptools import setup setup( name='pytest-ui', description='Text User Interface for running python tests', version='0.1', license='MIT', platforms=['linux', 'osx', 'win32'], packages=['pytui'], url='https://github.com/martinsmid/pytest-ui', author_email='[email protected]', ...
from setuptools import setup setup( name='pytest-ui', description='Text User Interface for running python tests', version='0.1', license='MIT', platforms=['linux', 'osx', 'win32'], packages=['pytui'], url='https://github.com/martinsmid/pytest-ui', author_email='[email protected]', ...
<commit_before>from setuptools import setup setup( name='pytest-ui', description='Text User Interface for running python tests', version='0.1', license='MIT', platforms=['linux', 'osx', 'win32'], packages=['pytui'], url='https://github.com/martinsmid/pytest-ui', author_email='martin.smi...
02b761e34c6cc26dc22f3d4f46de6a5b35731f78
setup.py
setup.py
from setuptools import setup from os import path here = path.abspath(path.dirname(__file__)) with open(path.join(here, 'README.md')) as f: jgo_long_description = f.read() setup( name='jgo', version='0.2.0', author='Philipp Hanslovsky, Curtis Rueden', author_email='[email protected]', ...
from setuptools import setup from os import path here = path.abspath(path.dirname(__file__)) with open(path.join(here, 'README.md')) as f: jgo_long_description = f.read() setup( name='jgo', version='0.2.1.dev0', author='Philipp Hanslovsky, Curtis Rueden', author_email='[email protected]...
Bump to next development cycle
Bump to next development cycle
Python
unlicense
ctrueden/jrun,ctrueden/jrun
from setuptools import setup from os import path here = path.abspath(path.dirname(__file__)) with open(path.join(here, 'README.md')) as f: jgo_long_description = f.read() setup( name='jgo', version='0.2.0', author='Philipp Hanslovsky, Curtis Rueden', author_email='[email protected]', ...
from setuptools import setup from os import path here = path.abspath(path.dirname(__file__)) with open(path.join(here, 'README.md')) as f: jgo_long_description = f.read() setup( name='jgo', version='0.2.1.dev0', author='Philipp Hanslovsky, Curtis Rueden', author_email='[email protected]...
<commit_before>from setuptools import setup from os import path here = path.abspath(path.dirname(__file__)) with open(path.join(here, 'README.md')) as f: jgo_long_description = f.read() setup( name='jgo', version='0.2.0', author='Philipp Hanslovsky, Curtis Rueden', author_email='hanslovskyp@janel...
from setuptools import setup from os import path here = path.abspath(path.dirname(__file__)) with open(path.join(here, 'README.md')) as f: jgo_long_description = f.read() setup( name='jgo', version='0.2.1.dev0', author='Philipp Hanslovsky, Curtis Rueden', author_email='[email protected]...
from setuptools import setup from os import path here = path.abspath(path.dirname(__file__)) with open(path.join(here, 'README.md')) as f: jgo_long_description = f.read() setup( name='jgo', version='0.2.0', author='Philipp Hanslovsky, Curtis Rueden', author_email='[email protected]', ...
<commit_before>from setuptools import setup from os import path here = path.abspath(path.dirname(__file__)) with open(path.join(here, 'README.md')) as f: jgo_long_description = f.read() setup( name='jgo', version='0.2.0', author='Philipp Hanslovsky, Curtis Rueden', author_email='hanslovskyp@janel...
5eb03f5ebc33cb13d80757f7b44330ef6b56b902
setup.py
setup.py
#!/usr/bin/env python from setuptools import setup with open('README.md', 'r') as readme_f: long_description = readme_f.read() setup( name='py-wasapi-client', version='1.1.0', url='https://github.com/unt-libraries/py-wasapi-client', author='University of North Texas Libraries', author_email...
#!/usr/bin/env python from setuptools import setup with open('README.md', 'r') as readme_f: long_description = readme_f.read() setup( name='py-wasapi-client', version='1.1.0', url='https://github.com/unt-libraries/py-wasapi-client', author='University of North Texas Libraries', author_email...
Add Webrecorder to short description
Add Webrecorder to short description
Python
bsd-3-clause
unt-libraries/py-wasapi-client
#!/usr/bin/env python from setuptools import setup with open('README.md', 'r') as readme_f: long_description = readme_f.read() setup( name='py-wasapi-client', version='1.1.0', url='https://github.com/unt-libraries/py-wasapi-client', author='University of North Texas Libraries', author_email...
#!/usr/bin/env python from setuptools import setup with open('README.md', 'r') as readme_f: long_description = readme_f.read() setup( name='py-wasapi-client', version='1.1.0', url='https://github.com/unt-libraries/py-wasapi-client', author='University of North Texas Libraries', author_email...
<commit_before>#!/usr/bin/env python from setuptools import setup with open('README.md', 'r') as readme_f: long_description = readme_f.read() setup( name='py-wasapi-client', version='1.1.0', url='https://github.com/unt-libraries/py-wasapi-client', author='University of North Texas Libraries', ...
#!/usr/bin/env python from setuptools import setup with open('README.md', 'r') as readme_f: long_description = readme_f.read() setup( name='py-wasapi-client', version='1.1.0', url='https://github.com/unt-libraries/py-wasapi-client', author='University of North Texas Libraries', author_email...
#!/usr/bin/env python from setuptools import setup with open('README.md', 'r') as readme_f: long_description = readme_f.read() setup( name='py-wasapi-client', version='1.1.0', url='https://github.com/unt-libraries/py-wasapi-client', author='University of North Texas Libraries', author_email...
<commit_before>#!/usr/bin/env python from setuptools import setup with open('README.md', 'r') as readme_f: long_description = readme_f.read() setup( name='py-wasapi-client', version='1.1.0', url='https://github.com/unt-libraries/py-wasapi-client', author='University of North Texas Libraries', ...
ab8b6ed75f27820ce2711d597838584fe68e62ef
setup.py
setup.py
#!python import os from distutils.core import setup filepath = os.path.dirname(__file__) readme_file = os.path.join(filepath, 'README.md') try: import pypandoc long_description = pypandoc.convert(readme_file, 'rst') except(IOError, ImportError): long_description = open(readme_file).read() def extract_ver...
#!python import os from distutils.core import setup description = 'Cmdlet provides pipe-like mechanism to cascade functions and generators.' filepath = os.path.dirname(__file__) readme_file = os.path.join(filepath, 'README.md') if not os.path.exist(readme_file): long_description = description else: try: ...
Use short description if README.md not found.
Use short description if README.md not found.
Python
mit
GaryLee/cmdlet
#!python import os from distutils.core import setup filepath = os.path.dirname(__file__) readme_file = os.path.join(filepath, 'README.md') try: import pypandoc long_description = pypandoc.convert(readme_file, 'rst') except(IOError, ImportError): long_description = open(readme_file).read() def extract_ver...
#!python import os from distutils.core import setup description = 'Cmdlet provides pipe-like mechanism to cascade functions and generators.' filepath = os.path.dirname(__file__) readme_file = os.path.join(filepath, 'README.md') if not os.path.exist(readme_file): long_description = description else: try: ...
<commit_before>#!python import os from distutils.core import setup filepath = os.path.dirname(__file__) readme_file = os.path.join(filepath, 'README.md') try: import pypandoc long_description = pypandoc.convert(readme_file, 'rst') except(IOError, ImportError): long_description = open(readme_file).read() ...
#!python import os from distutils.core import setup description = 'Cmdlet provides pipe-like mechanism to cascade functions and generators.' filepath = os.path.dirname(__file__) readme_file = os.path.join(filepath, 'README.md') if not os.path.exist(readme_file): long_description = description else: try: ...
#!python import os from distutils.core import setup filepath = os.path.dirname(__file__) readme_file = os.path.join(filepath, 'README.md') try: import pypandoc long_description = pypandoc.convert(readme_file, 'rst') except(IOError, ImportError): long_description = open(readme_file).read() def extract_ver...
<commit_before>#!python import os from distutils.core import setup filepath = os.path.dirname(__file__) readme_file = os.path.join(filepath, 'README.md') try: import pypandoc long_description = pypandoc.convert(readme_file, 'rst') except(IOError, ImportError): long_description = open(readme_file).read() ...
d765eaa608ff1b12423d65c447a27d65eec38988
setup.py
setup.py
#!/usr/bin/python from setuptools import setup from distutils.extension import Extension from Pyrex.Distutils import build_ext setup( name="PyMoira", version="4.3.1", description="PyMoira - Python bindings for the Athena Moira library", author="Evan Broder", author_email="[email protected]", lice...
#!/usr/bin/python from setuptools import setup from distutils.extension import Extension from Pyrex.Distutils import build_ext setup( name="PyMoira", version="4.3.2", description="PyMoira - Python bindings for the Athena Moira library", author="Evan Broder", author_email="[email protected]", lice...
Stop shipping qy with python-moira
Stop shipping qy with python-moira Moira now provides with its own native qy.
Python
mit
mit-athena/python-moira
#!/usr/bin/python from setuptools import setup from distutils.extension import Extension from Pyrex.Distutils import build_ext setup( name="PyMoira", version="4.3.1", description="PyMoira - Python bindings for the Athena Moira library", author="Evan Broder", author_email="[email protected]", lice...
#!/usr/bin/python from setuptools import setup from distutils.extension import Extension from Pyrex.Distutils import build_ext setup( name="PyMoira", version="4.3.2", description="PyMoira - Python bindings for the Athena Moira library", author="Evan Broder", author_email="[email protected]", lice...
<commit_before>#!/usr/bin/python from setuptools import setup from distutils.extension import Extension from Pyrex.Distutils import build_ext setup( name="PyMoira", version="4.3.1", description="PyMoira - Python bindings for the Athena Moira library", author="Evan Broder", author_email="broder@mit...
#!/usr/bin/python from setuptools import setup from distutils.extension import Extension from Pyrex.Distutils import build_ext setup( name="PyMoira", version="4.3.2", description="PyMoira - Python bindings for the Athena Moira library", author="Evan Broder", author_email="[email protected]", lice...
#!/usr/bin/python from setuptools import setup from distutils.extension import Extension from Pyrex.Distutils import build_ext setup( name="PyMoira", version="4.3.1", description="PyMoira - Python bindings for the Athena Moira library", author="Evan Broder", author_email="[email protected]", lice...
<commit_before>#!/usr/bin/python from setuptools import setup from distutils.extension import Extension from Pyrex.Distutils import build_ext setup( name="PyMoira", version="4.3.1", description="PyMoira - Python bindings for the Athena Moira library", author="Evan Broder", author_email="broder@mit...
f4d33519c9ed78887de8040c865e94d6b0430077
setup.py
setup.py
from setuptools import setup, find_packages version = '1.3.5' setup(name='switchboard', version=version, description="Feature flipper for Pyramid, Pylons, or TurboGears apps.", # http://www.python.org/pypi?%3Aaction=list_classifiers classifiers=[ "Programming Language :: Python", ...
from setuptools import setup, find_packages version = '1.3.5' setup(name='switchboard', version=version, description="Feature flipper for Pyramid, Pylons, or TurboGears apps.", # http://www.python.org/pypi?%3Aaction=list_classifiers classifiers=[ "Programming Language :: Python", ...
Allow any pymongo 2.x version
Allow any pymongo 2.x version
Python
apache-2.0
kadams54/switchboard,switchboardpy/switchboard
from setuptools import setup, find_packages version = '1.3.5' setup(name='switchboard', version=version, description="Feature flipper for Pyramid, Pylons, or TurboGears apps.", # http://www.python.org/pypi?%3Aaction=list_classifiers classifiers=[ "Programming Language :: Python", ...
from setuptools import setup, find_packages version = '1.3.5' setup(name='switchboard', version=version, description="Feature flipper for Pyramid, Pylons, or TurboGears apps.", # http://www.python.org/pypi?%3Aaction=list_classifiers classifiers=[ "Programming Language :: Python", ...
<commit_before>from setuptools import setup, find_packages version = '1.3.5' setup(name='switchboard', version=version, description="Feature flipper for Pyramid, Pylons, or TurboGears apps.", # http://www.python.org/pypi?%3Aaction=list_classifiers classifiers=[ "Programming Language ...
from setuptools import setup, find_packages version = '1.3.5' setup(name='switchboard', version=version, description="Feature flipper for Pyramid, Pylons, or TurboGears apps.", # http://www.python.org/pypi?%3Aaction=list_classifiers classifiers=[ "Programming Language :: Python", ...
from setuptools import setup, find_packages version = '1.3.5' setup(name='switchboard', version=version, description="Feature flipper for Pyramid, Pylons, or TurboGears apps.", # http://www.python.org/pypi?%3Aaction=list_classifiers classifiers=[ "Programming Language :: Python", ...
<commit_before>from setuptools import setup, find_packages version = '1.3.5' setup(name='switchboard', version=version, description="Feature flipper for Pyramid, Pylons, or TurboGears apps.", # http://www.python.org/pypi?%3Aaction=list_classifiers classifiers=[ "Programming Language ...
706dbcc5208cdebe616e387b280aa7411d4bdc42
setup.py
setup.py
# coding: utf-8 from setuptools import setup, find_packages setup( name = 'thumbor_aws', version = "1", description = 'Thumbor AWS extensions', author = 'William King', author_email = '[email protected]', zip_safe = False, include_package_data = True, packages=find_packages(), install_requires=['py-dateut...
# coding: utf-8 from setuptools import setup, find_packages setup( name = 'thumbor_aws', version = "1", description = 'Thumbor AWS extensions', author = 'William King', author_email = '[email protected]', zip_safe = False, include_package_data = True, packages=find_packages(), install_requires=['python-da...
Use python-dateutil instead of py-dateutil
Use python-dateutil instead of py-dateutil
Python
mit
voxmedia/aws,bob3000/thumbor_aws,pgr0ss/aws,andrew-a-dev/aws,aoqfonseca/aws,tsauzeau/aws,thumbor-community/aws,guilhermef/aws,ScrunchEnterprises/thumbor_aws,abaldwin1/tc_aws
# coding: utf-8 from setuptools import setup, find_packages setup( name = 'thumbor_aws', version = "1", description = 'Thumbor AWS extensions', author = 'William King', author_email = '[email protected]', zip_safe = False, include_package_data = True, packages=find_packages(), install_requires=['py-dateut...
# coding: utf-8 from setuptools import setup, find_packages setup( name = 'thumbor_aws', version = "1", description = 'Thumbor AWS extensions', author = 'William King', author_email = '[email protected]', zip_safe = False, include_package_data = True, packages=find_packages(), install_requires=['python-da...
<commit_before># coding: utf-8 from setuptools import setup, find_packages setup( name = 'thumbor_aws', version = "1", description = 'Thumbor AWS extensions', author = 'William King', author_email = '[email protected]', zip_safe = False, include_package_data = True, packages=find_packages(), install_requi...
# coding: utf-8 from setuptools import setup, find_packages setup( name = 'thumbor_aws', version = "1", description = 'Thumbor AWS extensions', author = 'William King', author_email = '[email protected]', zip_safe = False, include_package_data = True, packages=find_packages(), install_requires=['python-da...
# coding: utf-8 from setuptools import setup, find_packages setup( name = 'thumbor_aws', version = "1", description = 'Thumbor AWS extensions', author = 'William King', author_email = '[email protected]', zip_safe = False, include_package_data = True, packages=find_packages(), install_requires=['py-dateut...
<commit_before># coding: utf-8 from setuptools import setup, find_packages setup( name = 'thumbor_aws', version = "1", description = 'Thumbor AWS extensions', author = 'William King', author_email = '[email protected]', zip_safe = False, include_package_data = True, packages=find_packages(), install_requi...