text
stringlengths 24
36
|
|---|
P15112 PPI Q55GJ7 string
|
Q3UMB5 PPI Q91YI1 string
|
O13955 PPI O14186 string
|
O94763 PPI P36873 string;uniprot
|
P23680 PPI Q9ES38 string
|
P93830 PPI Q9ZSY8 uniprot
|
P20351 PPI Q9VYA0 string
|
P0A6N3 PPI P0AG69 string
|
O08586 PPI Q61221 string
|
P49441 PPI P49441 uniprot
|
P0CH34 PPI Q10GP0 string
|
P09558 PPI Q28997 string
|
P04839 PPI P04839 uniprot
|
P0AEW1 PPI P77423 string
|
P11216 PPI Q15124 string
|
Q02105 PPI Q8CFG9 string
|
P38771 PPI P53921 string
|
O75665 PPI Q1MSJ5 string
|
O24633 PPI Q9SZD4 string
|
P07901 PPI P26361 string
|
O35718 PPI P81122 string
|
P03023 PPI P03023 uniprot
|
P01030 PPI Q3MHN2 string
|
P04366 PPI P14477 string
|
Q9LFH5 PPI Q9LVC9 string
|
Q12959 PPI Q16539 string
|
P46459 PPI P51151 string
|
P32447 PPI P36012 string
|
P61963 PPI Q8CFD5 string
|
P35396 PPI Q9WU42 string
|
P07948 PPI P10721 string;uniprot
|
Q5U2T7 PPI Q91ZW1 string
|
P26644 PPI Q5M889 string
|
Q9P7C0 PPI Q9UT32 string
|
A6NI61 PPI P15173 string
|
A0A0G2K344 PPI Q5U2U2 string
|
P51418 PPI Q9FFS8 string
|
Q0WPF2 PPI Q9FJN9 string
|
Q8W5S1 PPI Q9M322 string
|
P02889 PPI Q54BC8 string
|
O95867 PPI O95868 string
|
Q6NPD7 PPI Q8VYR2 string
|
P51102 PPI Q9FFQ4 string
|
P11172 PPI Q9UHQ9 string
|
Q05922 PPI Q61831 string
|
O04603 PPI O81235 string
|
P01282 PPI P01308 string
|
O35659 PPI P01326 string
|
P15379 PPI P28653 string
|
A4GSN8 PPI Q8GWR1 string
|
O01757 PPI Q20709 string
|
Q12959 PPI Q9NS75 uniprot
|
P37751 PPI P76275 string
|
P29597 PPI Q14627 string
|
Q04837 PPI Q9Y291 string
|
Q8NCP5 PPI Q9BXS5 uniprot
|
P05748 PPI P51402 string
|
P04351 PPI P09793 string
|
Q96RK4 PPI Q9H0F7 string
|
O80501 PPI Q8LLD4 string
|
Q7KTX8 PPI Q9GYV9 string
|
Q8LPR8 PPI Q9LUS2 string
|
O09106 PPI Q8C2B3 string
|
P0ACD8 PPI P24183 string
|
P0A6P3 PPI P0ADY5 string
|
O75909 PPI Q07002 uniprot
|
O14062 PPI P05752 string
|
G5EGP4 PPI Q9XW92 string
|
Q9BZJ0 PPI Q9UNP9 string
|
P37276 PPI Q24117 string
|
O95298 PPI Q16718 string
|
O08689 PPI P11531 string
|
Q8VZB9 PPI Q9C9C5 string
|
P0C016 PPI Q9US13 string
|
P97452 PPI Q9JIK5 string
|
O00148 PPI Q8NI27 string
|
P68433 PPI Q920B9 string
|
Q53HL2 PPI Q9BSJ5 string
|
P97371 PPI Q9CWH6 string
|
P30050 PPI Q07020 string
|
P00429 PPI Q01321 string
|
P09632 PPI P41778 string;uniprot
|
Q7K550 PPI Q9VWG3 string
|
P24785 PPI Q9VH07 string
|
O04846 PPI P49227 string
|
P01138 PPI P22455 string
|
P63325 PPI Q9D823 string
|
P51422 PPI Q9STY6 string
|
P42859 PPI Q01853 string
|
O35904 PPI P70182 string
|
P25439 PPI Q8IN94 string;uniprot
|
O15120 PPI P43304 string
|
Q9V444 PPI Q9VJV8 string
|
P9WFC7 PPI P9WNC3 string
|
P26446 PPI P27089 string
|
P04792 PPI Q49AJ0 uniprot
|
Q3ZC04 PPI Q5EA71 string
|
Q42202 PPI Q9FFR6 string
|
Q06432 PPI Q7RTX7 string
|
P32100 PPI Q9V597 string
|
End of preview. Expand
in Data Studio
PRING Raw Data
This directory contains the raw data files used in the PRING benchmark.
These files can be used to regenerate the processed datasets or to extend the benchmark with additional species. Data processing scripts are available in the PRING GitHub repository.
1. Data Format
This directory includes two files:
ppi.txt
Contains protein–protein interaction (PPI) data. The format is:
uniprot_id_1 PPI uniprot_id_2 data_source
P15112 PPI Q55GJ7 string
idmapping.fasta
Contains protein sequences in FASTA format. Each entry begins with a header line (>), followed by the UniProt ID, metadata, and the amino acid sequence. Example:
> sp|P50399|GDIB_RAT Rab GDP dissociation inhibitor beta OS=Rattus norvegicus OX=10116 GN=Gdi2 PE=1 SV=2
> MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDQNPYYGGESASITPLEDLYKRFKLPG
> ...
> YKRMTGSEFDFEEMKRKKNDIYGED
The OX field in the header specifies the NCBI taxonomy ID, which can be used to filter sequences by species.
2. Data Sources
The interactions in ppi.txt are aggregated from multiple curated databases, including:
STRING, IntAct, Reactome, and UniProt.
Citation
If you find PRING useful, please consider citing:
@article{zheng2025pring,
title={PRING: Rethinking Protein-Protein Interaction Prediction from Pairs to Graphs},
author={Zheng, Xinzhe and Du, Hao and Xu, Fanding and Li, Jinzhe and Liu, Zhiyuan and Wang, Wenkang and Chen, Tao and Ouyang, Wanli and Li, Stan Z and Lu, Yan and others},
journal={arXiv preprint arXiv:2507.05101},
year={2025}
}
@inproceedings{zheng2025pring,
title={{PRING}: Rethinking Protein-Protein Interaction Prediction from Pairs to Graphs},
author={Xinzhe Zheng and Hao Du and Fanding Xu and Jinzhe Li and Zhiyuan Liu and Wenkang Wang and Tao Chen and Wanli Ouyang and Stan Z. Li and Yan Lu and Nanqing Dong and Yang Zhang},
booktitle={The Thirty-ninth Annual Conference on Neural Information Processing Systems (NeurIPS) Datasets and Benchmarks Track},
year={2025},
url={https://openreview.net/forum?id=mHCOVlFXTw}
}
Further Information
For dataset regeneration instructions and additional details, please refer to the PRING GitHub repository.
- Downloads last month
- 21